KEGG   Streptococcus agalactiae ILRI112: SAIL_20480Help
Entry
SAIL_20480        CDS       T02705                                 

Definition
(GenBank) Glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
sagr  Streptococcus agalactiae ILRI112
Pathway
sagr00561  Glycerolipid metabolism
sagr00640  Propanoate metabolism
sagr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sagr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SAIL_20480
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SAIL_20480
Enzymes [BR:sagr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     SAIL_20480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Herpes_UL73
Motif
Other DBs
NCBI-ProteinID: CCW43058
Position
1897863..1898948
Genome map
AA seq 361 aa AA seqDB search
MTTNVMANYSYGEDCFKEIPSVLATYRIQSIAFVGGKRALDSSEAEVRSILEEANIKVTG
SFVYGTDSTQSNIDKLVANPQVQAADAILGFGGGKALDTAKMVAKELGKNSFTIPTICSN
CSAGTAIAVVYNDDHSFLRYGYPESPLHIFINTRIIAQAPSKYFWAGIGDGISKAPEVER
ATLEAKTNKLPHTAVLGQAVALSSKEAFYQFGEQGLKDVEANLASRAVEEIALDILISTG
YASNLVNQPDFYYNSCHAHAFYYGTTAIQRQGEFLHGVVVAFGVLVLHAYFNELEELEKV
ARFNKSLGLPTTLADVSLSEKDIPKIVEIAMTTNEYKNTPFDPKMFAQAILAADAFGQTL
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaatgtaatggcaaattatagctacggagaagattgcttcaaagaaattcct
agcgttttggcaacttaccgtattcaaagcattgctttcgtcggtggcaaacgtgcccta
gacagctcagaagccgaggttcgctctattttagaggaagcaaatattaaagtcacagga
agctttgtctatggaacggattcaacacaatctaacattgacaagttagtagccaaccca
caagttcaagctgctgatgctatcttaggttttggcggtggaaaagctttagacacagct
aaaatggtagcaaaagagttaggtaaaaatagctttactatcccaactatttgttctaat
tgctccgcaggtactgccattgcagttgtatataatgatgaccattctttcttaagatac
ggctatcccgagtctccacttcatatttttatcaatacacggatcattgcacaggcacca
agcaaatatttttgggctggtattggggacggtatttcaaaagcccctgaagtagaacgt
gctaccttagaggctaagaccaataaactaccacatactgcagtgttaggacaagcagtc
gctctgtcttcaaaggaagctttttatcaatttggtgaacaaggtctaaaagacgttgaa
gctaatttagcttcgcgtgcagttgaagaaattgcgcttgatatcttaatctcaactggc
tatgcttctaatttagttaatcaacctgatttctactacaattcttgtcacgcgcatgca
ttttactatggtacaaccgctattcaaagacaaggtgaattcttacatggcgttgtagtt
gcgtttggtgtgttagttttacatgcttatttcaacgaactagaagaacttgaaaaagta
gctcgttttaataagtcactaggtttgccaacaactctagctgacgtctctttatcagaa
aaagatattccaaaaattgttgaaattgcaatgactactaatgaatacaaaaatacccct
ttcgatcccaaaatgtttgctcaagctattttagcagcagacgctttcggacagacacta
gcctaa

DBGET integrated database retrieval system