KEGG   Streptococcus agalactiae ILRI112: SAIL_5830Help
Entry
SAIL_5830         CDS       T02705                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase @ Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sagr  Streptococcus agalactiae ILRI112
Pathway
sagr00071  Fatty acid degradation
sagr00072  Synthesis and degradation of ketone bodies
sagr00280  Valine, leucine and isoleucine degradation
sagr00310  Lysine degradation
sagr00362  Benzoate degradation
sagr00380  Tryptophan metabolism
sagr00620  Pyruvate metabolism
sagr00630  Glyoxylate and dicarboxylate metabolism
sagr00640  Propanoate metabolism
sagr00650  Butanoate metabolism
sagr00900  Terpenoid backbone biosynthesis
sagr01100  Metabolic pathways
sagr01110  Biosynthesis of secondary metabolites
sagr01120  Microbial metabolism in diverse environments
sagr01130  Biosynthesis of antibiotics
sagr01200  Carbon metabolism
sagr01212  Fatty acid metabolism
sagr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sagr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAIL_5830
   00630 Glyoxylate and dicarboxylate metabolism
    SAIL_5830
   00640 Propanoate metabolism
    SAIL_5830
   00650 Butanoate metabolism
    SAIL_5830
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAIL_5830
   00072 Synthesis and degradation of ketone bodies
    SAIL_5830
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAIL_5830
   00310 Lysine degradation
    SAIL_5830
   00380 Tryptophan metabolism
    SAIL_5830
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAIL_5830
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAIL_5830
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAIL_5830
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sagr04147]
    SAIL_5830
Enzymes [BR:sagr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAIL_5830
Exosome [BR:sagr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAIL_5830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: CCW41601
Position
493867..494982
Genome map
AA seq 371 aa AA seqDB search
MKNRDVYIGFGLRTPIGIKGKQFKHYRPELLGAHLLNQIKKIESESNIDSIICGNTVGTG
GNIGRLMTLFSDYESYIPVQTIDMQCASSSSALFFGYLKISTGINEKVLVGGIESSSLQP
MRRYAKEDNRNGEYTVAQFSPDSYAETVMLEGAQRVCQKYGFRREMLDKLAFLSHKRALT
AKQGGYLEEVILPMEGMRDQGVRKLKEAFFQKLPRLMENSPLLTTGNVCLMHDAAAFLTL
QSQKTEFRIVHIVEVAGDPKLSPELVHTATEKLLTETQTKISDYDAIEWNEPFAAIDALF
NHYYPEEREKFNIFGGALAYGHPYACSGIINILHLMQALKYKNKPMGLTAIAGAGGVGMA
ISIEYLGVKNA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatagagatgtttatattggttttgggctacgaacacctatcggtataaaaggg
aagcaatttaaacattaccgtccagaacttttaggagcacaccttttaaatcaaataaaa
aaaatagaatcagaatctaacattgatagtattatttgtgggaacacagttggtactggg
ggcaatattggtcgtttgatgactcttttttctgattatgaatcctatattccagtacaa
acgattgatatgcagtgtgcttcatcaagctctgccttgttttttggttatctaaaaatc
agtaccggtattaatgaaaaagttcttgttggggggattgaaagtagttctcttcaacct
atgagacgttacgctaaagaagataatcgtaacggagaatataccgttgctcagttttct
cctgactcttatgctgaaactgtaatgttagaaggggcccagagagtctgtcaaaaatat
ggttttagaagagaaatgttagataaattggcattcttgagccataaacgcgccttaaca
gctaaacaaggtggctatttagaagaggtaatcttaccaatggaagggatgcgagatcaa
ggtgttagaaaactaaaagaagcattttttcaaaaattaccaaggttgatggaaaattca
cctttgctcactactggaaatgtttgtttaatgcacgatgctgctgcatttctaacgctt
cagagtcagaaaacagaattccggattgttcacattgtagaagtagcaggagatcccaag
cttagtccagaattggttcacacggctacggaaaaactattaacagaaactcagactaaa
atatcggattatgatgcaattgaatggaatgaaccatttgcagcgattgatgctttattt
aatcattattatcctgaagagagagaaaaattcaatatttttggaggggcattagcttac
ggacacccttatgcctgctcaggaattattaatatccttcatcttatgcaggcattaaaa
tataaaaataaacctatgggcctaactgccattgcaggggcaggaggagtcggaatggcc
atatcaatagagtacttaggagttaagaatgcttga

DBGET integrated database retrieval system