KEGG   Streptococcus agalactiae SA20: SaSA20_0453Help
Entry
SaSA20_0453       CDS       T02338                                 

Gene name
atoB
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sags  Streptococcus agalactiae SA20
Pathway
sags00071  Fatty acid degradation
sags00072  Synthesis and degradation of ketone bodies
sags00280  Valine, leucine and isoleucine degradation
sags00362  Benzoate degradation
sags00380  Tryptophan metabolism
sags00620  Pyruvate metabolism
sags00630  Glyoxylate and dicarboxylate metabolism
sags00640  Propanoate metabolism
sags00650  Butanoate metabolism
sags00900  Terpenoid backbone biosynthesis
sags01100  Metabolic pathways
sags01110  Biosynthesis of secondary metabolites
sags01120  Microbial metabolism in diverse environments
sags01130  Biosynthesis of antibiotics
sags01200  Carbon metabolism
sags01212  Fatty acid metabolism
sags02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sags00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SaSA20_0453 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    SaSA20_0453 (atoB)
   00640 Propanoate metabolism
    SaSA20_0453 (atoB)
   00650 Butanoate metabolism
    SaSA20_0453 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SaSA20_0453 (atoB)
   00072 Synthesis and degradation of ketone bodies
    SaSA20_0453 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SaSA20_0453 (atoB)
   00310 Lysine degradation
    SaSA20_0453 (atoB)
   00380 Tryptophan metabolism
    SaSA20_0453 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SaSA20_0453 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SaSA20_0453 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SaSA20_0453 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sags04147]
    SaSA20_0453 (atoB)
Enzymes [BR:sags01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SaSA20_0453 (atoB)
Exosome [BR:sags04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SaSA20_0453 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AFV71929
Position
472483..473598
Genome map
AA seq 371 aa AA seqDB search
MKNRDVYIGFGLRTPIGIKGKQFKHYRPELLGAHLLNQIKKIESESNIDSIICGNTVGTG
GNIGRLMTLFSDYESYIPVQTIDMQCASSSSALFFGYLKISAGINEKVLVGGIESSSLQP
MRRYAKEDNRNGEYTVAQFSPDSYAETVMLEGAQRVCQKYGFRREMLDKLAFLSHKRALT
AKQGGYLEEVILPMEGMRDQGVRKLKETFFQKLPRLMENSPLLTIGNVCLMHDAAAFLTL
QSQKTEFRIVHIVEVAGDPKLSPELVHTTTEKLLTETPTKISDYDAIEWNEPFAAIDALF
NHYYPEEREKFNIFGGALAYGHPYACSGIINILHLMQALKYKNKPMGLTAIAGAGGVGMA
ISIEYLGVKNA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatagagatgtttatattggttttgggctacgaacacctatcggtataaaaggg
aagcaatttaaacattaccgtccagaacttttaggagcacacctcttaaatcaaataaaa
aaaatagaatcagaatctaatattgatagtattatttgtgggaacacggttggtactggg
ggcaatattggtcgtttgatgactcttttttctgattatgaatcctatattccagtacaa
acgattgatatgcagtgtgcttcatcaagttctgccttgttttttggttatctaaaaatc
agtgccggtattaatgaaaaagttcttgttggggggattgaaagtagttctcttcaacct
atgagacgttacgctaaagaagataatcgtaacggagaatataccgttgctcagttttct
cctgactcttatgctgaaactgtaatgttagaaggggcccagagagtctgtcaaaaatat
ggttttagaagagaaatgttagataaattggcattcttgagccataaacgcgccttaacg
gctaaacaaggtggctatttagaagaggtaatcttaccaatggaagggatgcgagatcaa
ggcgttagaaaactaaaagaaacattttttcaaaaattaccaaggttgatggaaaattca
cctttgctcactattggaaatgtttgtttaatgcatgatgctgctgcatttctaacgctt
cagagtcagaaaacagaattccggattgttcacattgtagaagtagcaggagatcccaag
cttagtccagaattggttcacacgactacggaaaaactattaacagaaactcctactaaa
atatcggattatgatgcaattgaatggaatgaaccatttgcagcgattgatgctttattt
aatcattattatcctgaagagagagaaaaattcaatatttttggaggggcattagcttac
ggacacccttatgcctgctcaggaattattaatatccttcatcttatgcaggcattaaaa
tataaaaataaacctatgggcctaactgccattgcaggggcaggaggagtcggaatggcc
atatcaatagagtacttaggagttaagaatgcttga

DBGET integrated database retrieval system