KEGG   Streptococcus agalactiae SA20: SaSA20_0941Help
Entry
SaSA20_0941       CDS       T02338                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
sags  Streptococcus agalactiae SA20
Pathway
sags00790  Folate biosynthesis
sags01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sags00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SaSA20_0941 (folE)
Enzymes [BR:sags01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SaSA20_0941 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI BCDHK_Adom3 TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AFV72400
UniProt: K0JNG7
Position
complement(995527..996090)
Genome map
AA seq 187 aa AA seqDB search
MPNQEKMEKAIYQFLEALGENPNREGLKDTPKRVAKMYIEMFSGLNQDPKEQFTAVFSEN
HEEVVIVKDIPFYSMCEHHLVPFYGKAHIAYLPNDGRVTGLSKLARAVEVASKRPQLQER
LTAQVAQALEDALAPKGIFVMIEAEHMCMTMRGIKKPGSKTITTVARGLYKDDRYERQEI
LSLIQKG
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgcccaatcaagaaaaaatggaaaaagctatttatcaatttttagaggctttaggagaa
aatcctaatcgagaaggattgaaagatacaccgaagcgtgtggcaaaaatgtatatagaa
atgttctcaggacttaatcaagatccaaaggagcaattcactgcagtcttttctgaaaat
catgaagaggttgtgattgtcaaggatattccattctattccatgtgtgaacatcatttg
gttcctttttatggtaaagctcatattgcttatttaccaaacgatggacgtgttactgga
cttagtaagcttgcacgtgcagttgaagtggcgagtaagcgtcctcaacttcaggaacgt
ttaacagcacaagttgcacaagctttagaggatgctttggcgcctaaaggtatttttgtt
atgatagaagcagagcatatgtgcatgacaatgcgtggcattaaaaaaccaggaagtaag
acgattacaacggtagctcgtggtttatacaaggacgatcgatatgaaagacaagaaatt
ctatcgctaatacaaaaaggataa

DBGET integrated database retrieval system