KEGG   Streptococcus agalactiae SA20: SaSA20_1356Help
Entry
SaSA20_1356       CDS       T02338                                 

Definition
(GenBank) Peptidase family M20
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sags  Streptococcus agalactiae SA20
Pathway
sags00300  Lysine biosynthesis
sags01100  Metabolic pathways
sags01120  Microbial metabolism in diverse environments
sags01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sags00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SaSA20_1356
Enzymes [BR:sags01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SaSA20_1356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Gasdermin
Motif
Other DBs
NCBI-ProteinID: AFV72802
UniProt: A0A2I6UR75
Position
complement(1415315..1416691)
Genome map
AA seq 458 aa AA seqDB search
MTLTNEENQIQKFLSDTIVQDDINILRDLIAIKSIFAQKVGLNDLASYLGEVFRKAGAEV
IIDDSYSAPFIVANFKSSKVDAKRIIFYNHYDTVPADEVEQWTEDPFTLSLRYGKMYGRG
VDDDKGHITARLSAVKKYLSRHKGELPLDITFIVEGAEESASVGLDYYLEKYQEQLQGAD
LIVWEDGPKNPKGQLEIAGGNKGIVTFDLSVSSADVDIHSSFGGVVDSSTWYLIQALNTL
RDNKGHILVEGIYDKVIPPTKRELELVEKYSYRSAKALEDAYQLVLPSLADSHKTFLRKL
YFEPSIAIEGITSGYQGEGVKTILPAYAKCKAEVRLVLGLTPKGVLDSIQNHLKENGFND
IELTYTLGEMSYRSDMSAPSILKVFDLAEQFYPEGVSLLPTSPGTGPMYLVHQALRAPIA
AFGIGHANSRDHGVDENVSIADYYTHIELVEALIESYE
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgactttaacaaacgaagaaaatcaaattcaaaagtttctatctgatactattgttcag
gatgatatcaatattttaagagatttaattgcaattaagtcaatttttgctcagaaagtt
ggtttaaatgacttagcaagctatcttggagaagttttcagaaaagctggcgcagaagtc
attatagatgacagctatagcgctccctttatcgtggcaaatttcaaatcatcaaaagta
gatgctaagcgtattattttttacaatcattatgatactgtaccagcagatgaggtagaa
cagtggactgaggacccttttacactttcacttcgatatggtaagatgtatggacgtggt
gtagatgatgataaaggtcacattaccgcacgtttatcagcagttaaaaaatatttatca
agacacaaaggggaacttcctctagatatcacttttattgtggaaggagcggaggaatca
gcttcagtaggccttgattattatttagaaaagtatcaagagcagctacaaggagctgat
ttgatcgtgtgggaagatggccctaaaaatcctaaaggacagttggaaattgctggtgga
aataaaggcattgtcacttttgatttatcagtaagttcagcggatgttgatattcattca
tcctttggtggggttgttgattcctcgacatggtatttaattcaagccctcaatacgtta
agggataacaaaggtcatatattggtagaaggtatttatgataaagttattccccctact
aagagagagttagaattagttgaaaaatattcttatagatctgcaaaggcgctagaagat
gcttaccaattagttttgcccagtttagcagatagtcataaaacttttttgagaaagctt
tattttgaaccttctatagccattgaaggtataacctcaggctatcaaggtgaaggcgtc
aaaacaattttacctgcttatgctaaatgtaaagcagaggttaggttagtgctggggtta
accccgaaaggtgtactagattcaatacaaaatcatttgaaagagaatggctttaatgac
attgagctaacctatacccttggtgaaatgtcttatcgtagtgatatgtcagcgccatct
atcctaaaggtttttgatttagctgagcaattttatccagaaggggtatctctgttacct
acctcaccaggtacaggaccaatgtatttagttcatcaagctctaagagcgccaattgca
gcttttggcataggacatgccaatagtcgagaccatggcgttgatgaaaatgttagtatt
gctgattattacacccatattgaattagtggaggctttaatagaatcatatgagtaa

DBGET integrated database retrieval system