KEGG   Streptococcus agalactiae SA20: SaSA20_1707Help
Entry
SaSA20_1707       CDS       T02338                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction ATP-dependent DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sags  Streptococcus agalactiae SA20
Pathway
sags03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sags00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SaSA20_1707 (ruvA)
Enzymes [BR:sags01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SaSA20_1707 (ruvA)
DNA repair and recombination proteins [BR:sags03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SaSA20_1707 (ruvA)
    RecFOR pathway proteins
     SaSA20_1707 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH HHH_3
Motif
Other DBs
NCBI-ProteinID: AFV73140
UniProt: A0A2I6XAG5
Position
complement(1770746..1771336)
Genome map
AA seq 196 aa AA seqDB search
MYDYIKGKLSKITAKFIVVETAGLGYVIYVANPYSFSGYVNQEVTIYLHQVIRDDAHLLF
GFHTENEKEIFLNLISVSGIGPTTALAIIAVDDNEGLVSAIDNSDIKYLTKFPKIGKKTA
QQMILDLSGKFVEASGESATSRKVSSEQNSNLEEAMEALLALGYKATELKKVKVFFEGTN
ETVEQYIKSSLKMLMK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtacgattatattaaaggaaaattgagtaaaataacagctaaatttattgttgtggaa
acagctggattgggatatgtgatatatgtggcaaatccctactctttttcaggttacgtt
aatcaagaagttaccatctacttacatcaagtcattcgcgatgatgcacatcttttattt
ggttttcatacggaaaatgaaaaagaaatttttcttaatttaatttcagtatcaggaatt
ggtccaacgaccgctttagcaattattgcagtcgatgacaatgaaggtctcgtaagtgcc
attgataatagtgatattaagtatttgactaaatttccaaagataggaaaaaaaacagca
caacagatgatccttgatttgtcagggaagtttgtagaagcttctggagagagtgcgact
agtcgtaaggttagctctgagcagaatagcaatcttgaagaagctatggaagctttgtta
gcgttggggtataaggcgactgaattgaaaaaagtaaaagtcttttttgaaggtacgaac
gagactgtggagcaatacatcaaatctagtttgaagatgttgatgaaataa

DBGET integrated database retrieval system