KEGG   Streptococcus agalactiae COH1: GBSCOH1_0450Help
Entry
GBSCOH1_0450      CDS       T03434                                 

Definition
(GenBank) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sagt  Streptococcus agalactiae COH1
Pathway
sagt00071  Fatty acid degradation
sagt00072  Synthesis and degradation of ketone bodies
sagt00280  Valine, leucine and isoleucine degradation
sagt00310  Lysine degradation
sagt00362  Benzoate degradation
sagt00380  Tryptophan metabolism
sagt00620  Pyruvate metabolism
sagt00630  Glyoxylate and dicarboxylate metabolism
sagt00640  Propanoate metabolism
sagt00650  Butanoate metabolism
sagt00900  Terpenoid backbone biosynthesis
sagt01100  Metabolic pathways
sagt01110  Biosynthesis of secondary metabolites
sagt01120  Microbial metabolism in diverse environments
sagt01130  Biosynthesis of antibiotics
sagt01200  Carbon metabolism
sagt01212  Fatty acid metabolism
sagt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sagt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GBSCOH1_0450
   00630 Glyoxylate and dicarboxylate metabolism
    GBSCOH1_0450
   00640 Propanoate metabolism
    GBSCOH1_0450
   00650 Butanoate metabolism
    GBSCOH1_0450
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GBSCOH1_0450
   00072 Synthesis and degradation of ketone bodies
    GBSCOH1_0450
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GBSCOH1_0450
   00310 Lysine degradation
    GBSCOH1_0450
   00380 Tryptophan metabolism
    GBSCOH1_0450
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GBSCOH1_0450
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GBSCOH1_0450
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GBSCOH1_0450
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sagt04147]
    GBSCOH1_0450
Enzymes [BR:sagt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GBSCOH1_0450
Exosome [BR:sagt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GBSCOH1_0450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: CDN65916
Position
483142..484257
Genome map
AA seq 371 aa AA seqDB search
MKNRDVYIGFGLRTPIGIKGKQFKHYRPELLGAHLLNQIKKIESESNIDSIICGNTVGTG
GNIGRLMTLFSDYESYIPVQTIDMQCASSSSALFFGYLKISAGINEKVLVGGIESSSLQP
MRRYAKEDNRNGEYTVAQFSPDSYAETVMLEGAQRVCQKYGFRREMLDKLAFLSHKRALT
AKQGGYLEEVILPMEGMRDQGVRKLKEAFFQKLPRLMENSPLLTIGNVCLMHDAAAFLTL
QSQKTEFRIVHIVEVAGDPKLSPELVHTATEKLLTETHTKISDYDAIEWNEPFAAIDALF
NHYYPEEREKFNIFGGALAYGHPYACSGIINILHLMQALKYKNKPMGLTAIAGAGGVGMA
ISIEYLGVKNA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatagagatgtttatattggttttgggctacgaacacctatcggtataaaaggg
aagcaatttaaacattaccgtccagaacttttaggagcacacctcttaaatcaaataaaa
aaaatagaatcagaatctaatattgatagtattatttgtgggaacacagttggtactggg
ggcaatattggtcgtttgatgactcttttttctgattatgaatcctatattccagtacaa
acgattgatatgcagtgtgcttcatcaagttctgccttgttttttggttatctaaaaatc
agtgccggtattaatgaaaaagttcttgttggggggattgaaagtagttctcttcaacct
atgagacgttacgctaaagaagataatcgtaacggagaatataccgttgctcagttttct
cctgactcttatgctgaaactgtaatgttagaaggggcacaaagagtctgtcaaaaatat
ggttttagaagagaaatgttagataaattggcattcttgagccataaacgcgccttaaca
gctaaacaaggtggctatttagaagaggtaatcttaccaatggaagggatgcgagatcaa
ggcgttagaaaactaaaagaagcattttttcaaaaattaccaagattgatggaaaattca
cctttgctcactattggaaatgtttgtttaatgcacgatgctgctgcatttctaacgctt
cagagtcagaaaacagaattccggattgttcacattgtagaagtagcaggagatcccaag
cttagtccagaattggttcacacggctacggaaaaactattaacagaaactcatactaaa
atatcggattatgatgcaattgaatggaatgaaccatttgcagcgattgatgctttattt
aatcattattatcctgaagagagagaaaaattcaatatttttggaggggcattagcttac
ggacacccttatgcctgctcaggaattattaatatccttcatcttatgcaggcattaaaa
tataaaaataaacctatgggtctaactgccattgcaggggcaggaggagtcggaatggcc
atatcaatagagtacttaggagttaagaatgcttga

DBGET integrated database retrieval system