KEGG   Streptococcus agalactiae COH1: GBSCOH1_0481Help
Entry
GBSCOH1_0481      CDS       T03434                                 

Definition
(GenBank) geranyltranstransferase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
sagt  Streptococcus agalactiae COH1
Pathway
sagt00900  Terpenoid backbone biosynthesis
sagt01100  Metabolic pathways
sagt01110  Biosynthesis of secondary metabolites
sagt01130  Biosynthesis of antibiotics
Module
sagt_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:sagt00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GBSCOH1_0481
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:sagt01006]
    GBSCOH1_0481
Enzymes [BR:sagt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     GBSCOH1_0481
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     GBSCOH1_0481
    2.5.1.29  geranylgeranyl diphosphate synthase
     GBSCOH1_0481
Prenyltransferases [BR:sagt01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   GBSCOH1_0481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt V-SNARE_C
Motif
Other DBs
NCBI-ProteinID: CDN65947
Position
514449..515321
Genome map
AA seq 290 aa AA seqDB search
MVTIEKIDEAIHRHYKQTHSVVSPDLIKAILYSVDGGGKRIRPRILLEILEGFGVELIDG
HYDVAAALEMIHTGSLIHDDLPAMDNDDFRRGRLTNHKKFDEATAVLAGDSLFLDPFDLV
VKAGFKADVTVRLIELLSMSAGSFGMVGGQMLDMKGENKVLSIDDLSLIHINKTGRLLAY
PFVAAGILAEKSEEVKGKLHQAGLLIGHAFQVRDDILDVTASFEELGKTPNKDIVAEKTT
YPNLLGLDKSQEILDDTLKKAQAIFQNLEKKANFNARKIIDIIEGLRLNG
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggttactattgaaaaaattgatgaagctattcatcgtcattacaaacagacacatagt
gtcgtttctcctgatttaattaaggctatcctctactcagttgatggaggtgggaaacgt
attcgtccacgcatccttttagaaattttagagggatttggagttgaactaatagatggt
cattatgatgtggctgctgctttggagatgattcacactggctctttaattcatgatgat
ttaccggcgatggataatgatgattttcgtcgtggccgcttaacaaaccataaaaagttt
gatgaagctacagcggttttagctggagattccctttttttagacccatttgatttagtt
gtaaaagctggttttaaagctgatgttactgttaggttaatagagttattgtctatgtct
gcgggtagttttggcatggttggtggacaaatgttagatatgaagggagaaaacaaagtt
ttatctattgacgatttaagcttgattcatattaataaaacgggacgcctgttagcttat
ccctttgttgcagcaggtattttagctgagaagtcggaagaagtaaaaggaaaactgcat
caagctggccttttaatcggtcatgcttttcaagtacgtgatgatattttagatgtgact
gctagttttgaagaattgggtaagacaccaaataaagacattgtagcagaaaagacaact
tatccaaatttattgggtttggataagtcacaggaaatacttgacgatactttgaaaaaa
gctcaggcaatttttcaaaatctagagaaaaaagctaactttaatgctagaaaaataata
gatataatagagggattacggttgaatggctaa

DBGET integrated database retrieval system