KEGG   Streptococcus agalactiae COH1: GBSCOH1_1411Help
Entry
GBSCOH1_1411      CDS       T03434                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sagt  Streptococcus agalactiae COH1
Pathway
sagt00450  Selenocompound metabolism
sagt00970  Aminoacyl-tRNA biosynthesis
sagt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sagt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    GBSCOH1_1411
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GBSCOH1_1411
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sagt01007]
    GBSCOH1_1411
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sagt03016]
    GBSCOH1_1411
Enzymes [BR:sagt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     GBSCOH1_1411
Amino acid related enzymes [BR:sagt01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   GBSCOH1_1411
Transfer RNA biogenesis [BR:sagt03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    GBSCOH1_1411
 Prokaryotic type
   Other AARSs
    GBSCOH1_1411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: CDN66877
Position
complement(1482536..1484533)
Genome map
AA seq 665 aa AA seqDB search
MTEKKSFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRMMGFDVQYLTGLDEHGQKIQQ
KAEEAGITPQEYVDGMAESVKTLWELLDISYDKFIRTTDTYHEEAVAKIFEQLLAQGDIY
LDEYTGWYSVSDEEFFTESQLAEVYRDENGNMIGGVAPSGHEVEKVSEESYFFRMSKYAD
RLKAYYAEHPEFIQPDGRMNEMLKNFIEPGLEDLAVSRTTYTWGVQVPSNPKHVIYVWID
ALMNYISALGYGWSDDLSQYHKFWPADIHMIGKDILRFHSIYWPIMLMALDLPLPKRLVA
HGWFVMQDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINY
ELANDLGNLLNRTIAMVNKYFDGEVPRFAVATDFDADLASVATDSIENYHKQMEAVDFPR
ALEAVWNLISRTNKYIDETAPWVLAKDETDRDKLAAVMSHLVASLRVVAHLIQPFMMETS
DAIMEQLGLGATFDLEKLTFADLPEGVRVVAKGSPIFPRLDMEDEITYIKEQMNAGKAPV
EKEWVPEEVELTSSKGQIKFEDFDAVEIRVAEVIEVEKVEGSDKLLRFRLDAGDEGHRQI
LSGIAKFYPNEQELVGKKLQIVANLKPRKMMKKYVSQGMILSAEHDGKLTVLTVDSAVAN
GSIIG
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaaaaaatcattttacattactaccccaatttattacccatcaggtaaattg
cacatcggttctgcctatacaacgatagcatgtgatgttttggcacgttacaaacgcatg
atgggctttgatgttcagtatttgactggtcttgatgagcatggtcagaaaattcaacaa
aaggctgaagaagcaggcattacaccacaggaatatgttgatggcatggctgaaagtgtc
aaaacattatgggaacttttagatatttcctatgacaaattcatccgtacaacagatact
taccatgaagaagcggttgctaaaatttttgaacaattgttggcacaaggggacatctat
cttgatgagtataccggatggtattctgtttcagatgaagaattttttactgaaagccaa
ttagcagaagtttatcgtgacgaaaacggtaatatgattggtggtgttgcgccatctggt
catgaagttgaaaaagtttctgaagaatcttatttcttccgcatgagcaaatatgcagat
cgtttaaaagcgtactacgctgagcatccagaatttattcagccagatggtcgtatgaat
gaaatgcttaaaaactttatagaaccaggtttagaagatttagcagtgtctcgtacaact
tacacatggggagttcaggtaccatcaaatccaaaacatgttatttatgtctggattgat
gctttgatgaactatatttctgctcttggttatggttggtctgacgatctcagtcaatat
cataaattttggccagcagacattcatatgattggtaaagatattcttcgtttccactct
atttattggcctatcatgttgatggcgctggatttgccattaccaaaacgtctagttgct
catggttggtttgtgatgcaagatggtaaaatgtctaaatcaaaagggaatgtcgtttat
ccagaaatgttagtagagcgttttggtcttgatccactccgttattatctcatgcgttca
ttgcctgttggttcagacggaacttttacgccagaagattatgttggacgtattaactat
gaacttgctaatgatttaggaaaccttctcaaccgcactattgctatggttaacaagtat
ttcgatggagaagtaccaaggtttgctgttgcaactgactttgatgccgatttagcttct
gttgcgacagatagtattgaaaactatcataaacaaatggaagcggtggatttcccacgt
gcccttgaagctgtatggaatcttatttcacgaactaacaaatatattgatgaaacagca
ccgtgggtacttgcaaaagacgaaacagatcgtgataagttagcagctgtaatgagtcat
ttagttgctagtctacgtgttgttgctcacctcattcaaccgttcatgatggaaacttcc
gatgccattatggaacaacttggtttaggggcaacattcgatcttgaaaaattgactttt
gctgatctaccagaaggtgttcgagttgttgcaaaaggttcaccaattttcccaaggttg
gatatggaagacgaaattacttatatcaaagaacaaatgaatgctggaaaagcaccagtg
gaaaaggagtgggttcctgaagaagttgaattgacatcaagcaaaggtcaaatcaagttt
gaggattttgacgctgttgaaatccgcgttgcagaagtaattgaagttgagaaagtggaa
ggttctgataaacttcttcgtttccgtctagatgctggtgatgagggccatcgtcaaatc
ttatcagggattgcaaaattttacccaaatgaacaagagttagtagggaaaaaactccaa
attgttgctaacctcaaaccacgtaaaatgatgaaaaaatatgtcagtcaaggcatgatt
ctctcagcagaacatgatggtaaattgacagtgttgacggtcgattcagcagtggcaaat
ggatcaattattggttaa

DBGET integrated database retrieval system