KEGG   Sagittula sp. P11: CDO87_04615Help
Entry
CDO87_04615       CDS       T05219                                 

Definition
(GenBank) farnesyl-diphosphate synthase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
sagu  Sagittula sp. P11
Pathway
sagu00900  Terpenoid backbone biosynthesis
sagu01100  Metabolic pathways
sagu01110  Biosynthesis of secondary metabolites
sagu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sagu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CDO87_04615
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:sagu01006]
    CDO87_04615
Enzymes [BR:sagu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     CDO87_04615
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     CDO87_04615
Prenyltransferases [BR:sagu01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   CDO87_04615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AUC52517
UniProt: A0A2K8W873
Position
complement(942496..943404)
Genome map
AA seq 302 aa AA seqDB search
MTDGSGQERTADIAPLGFEAALARAAELANGQISYALSGVPGPVAAAMRYAVEGGKALRA
FMVIEGARVFGIDRQHAAPAAGAIEALHAYSLVHDDLPCMDDDDMRRGKPTVHRKWDETT
AVLAGDALQALAFQLVTHTACPAERRLELVAGLAVAAGLRGMVGGQARDIAAESAETPLT
LEEITALQAGKTGALISWSCGAGAVMAGESTGPLRRYGNCLGLAFQIWDDVLDVEGDAAT
VGKAVGKDADRGKATFVSLLGMEGAKARAQELVHEACTSLDVYGDVADALRDAARFVISR
RN
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacggacggctccggacaggagcggacggcggacattgcgccgctcgggttcgaggcg
gcgcttgcccgtgccgccgagctggcgaatggccagatttcctatgccttgtcaggcgtg
ccgggaccggtggcggctgcgatgcgctatgcggtggagggcggcaaggcgctgcgggcc
ttcatggtcatcgaaggcgcgcgggtgttcggcatcgaccggcagcacgcggcacctgcg
gcgggcgccatcgaggcgctgcatgcctacagcctcgtgcacgacgatctaccctgcatg
gacgatgacgacatgcggcgcgggaaacccaccgtgcaccgcaagtgggacgagaccacc
gccgtcctggccggggatgcgctgcaggccctggccttccaactggtgacgcacacggcg
tgcccggcagaacgccgcctggagctggtcgccggactggcggtggcggcgggcctgcgc
ggcatggtcggcggacaggcgcgcgacatcgccgccgaaagcgccgagacgcccctgacg
ctggaggagatcaccgcccttcaagccggcaagaccggtgcgctgatctcctggtcctgc
ggggcgggcgcggtcatggcgggagaaagcacaggcccgctgcggcggtatggcaactgc
ctcgggctcgcattccagatctgggacgacgttctggacgtggaaggcgatgccgccacg
gtcggcaaggccgtgggcaaggacgcggatcgcggcaaagcaacctttgtcagcctcctc
gggatggaaggggcgaaggcgcgggctcaggaactcgtgcacgaagcctgcacatccctt
gacgtatacggtgacgtggctgacgccttgcgggacgccgcccgcttcgttatctcgcgg
cggaactga

DBGET integrated database retrieval system