KEGG   Sagittula sp. P11: CDO87_08480Help
Entry
CDO87_08480       CDS       T05219                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
sagu  Sagittula sp. P11
Pathway
sagu00903  Limonene and pinene degradation
sagu00930  Caprolactam degradation
sagu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sagu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CDO87_08480
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    CDO87_08480
Enzymes [BR:sagu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     CDO87_08480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Hydrolase_4 Abhydrolase_2
Motif
Other DBs
NCBI-ProteinID: AUC53229
UniProt: A0A2K8WA96
Position
complement(1733924..1734820)
Genome map
AA seq 298 aa AA seqDB search
MSWQLRLLNAQLRLLVKPRIGRTRAPEDAARSVDRGARFAVHPPFLRFQERPGGLFWISC
GKCAPRRVILYFHGGGYVSGSPHTHRAMLGVLSGMVAVEVVAPKYPLLQEEPFPAPFDAA
LAAWDRLMALGYRPGDVVLGGDSAGGGIALALLSALCLRREAPAGVVVFSPWVDLAMTGA
SLRSNAARDPLLPADRVAELTGMFLAGADPRDPRASPLYAEFPGCPPVMLTSSRAEILFS
EIGGMAKRLEEGGADVSHEIHPTAPHAWPLFQGWIPEARDTLARAARFVQASFDDGIR
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcagctgcggctgctgaacgcgcagttgcggctgttggtcaaaccccggatc
gggcgcacgcgcgcgccggaagacgcggcgcgcagcgtggatcgcggcgcgcgctttgcc
gtccatccgccgttcctgcggttccaggaacgtcctggcggcctgttctggatatcctgc
ggcaaatgtgcgccgcgccgagtcatcctctatttccacggtggcggctacgtgtctggc
agcccgcatacccaccgtgcgatgctgggcgtcctgtccggcatggtggcggtggaggtc
gtggcgccgaagtatccgctgttgcaggaggaacctttccccgcgcccttcgacgcggca
ctggccgcctgggatcgtctgatggcgctggggtaccgtccgggcgatgtcgtgctgggg
ggcgactcggcggggggcgggatcgcgctggccttgctgtcggccctctgcctgcggcgg
gaagccccggcgggcgtggtagtcttttccccgtgggtggaccttgccatgaccggtgcg
tctctccgctccaacgccgcgcgcgatccgttgttgccggccgacagggttgccgaactg
accggcatgttccttgccggggccgatccgcgcgacccgagggcctcgccgctctacgcg
gaattcccggggtgcccgcccgtgatgctcacgtcctcccgtgccgaaatcctgttcagc
gagatcggcggaatggcgaaacggctggaggaaggcggcgccgatgtctcgcatgagata
caccccaccgccccccatgcatggccgctgtttcagggctggattcccgaagcgcgggac
acgttggcccgcgcggcgcgcttcgttcaggcgtcgttcgacgatggcatccggtag

DBGET integrated database retrieval system