KEGG   Sagittula sp. P11: CDO87_09475Help
Entry
CDO87_09475       CDS       T05219                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
sagu  Sagittula sp. P11
Pathway
sagu00010  Glycolysis / Gluconeogenesis
sagu00071  Fatty acid degradation
sagu00350  Tyrosine metabolism
sagu00625  Chloroalkane and chloroalkene degradation
sagu00626  Naphthalene degradation
sagu00680  Methane metabolism
sagu01100  Metabolic pathways
sagu01110  Biosynthesis of secondary metabolites
sagu01120  Microbial metabolism in diverse environments
sagu01200  Carbon metabolism
sagu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sagu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDO87_09475
  09102 Energy metabolism
   00680 Methane metabolism
    CDO87_09475
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CDO87_09475
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CDO87_09475
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CDO87_09475
   00626 Naphthalene degradation
    CDO87_09475
Enzymes [BR:sagu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CDO87_09475
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     CDO87_09475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N UDPG_MGDP_dh_N ThiF
Motif
Other DBs
NCBI-ProteinID: AUC53410
UniProt: A0A2K8WAR6
Position
complement(1937106..1938218)
Genome map
AA seq 370 aa AA seqDB search
MRTKAAVALEAGKPLEVMEVNLEGPKAGEVLVEIKATGICHTDEFTLSGADPEGLFPAIL
GHEGAGVVLEVGPGVTSLKPGDHVIPLYTPECRQCEYCLNPKTNLCQAIRTTQGQGLMPD
GTSRFSMLDGTPILHYMGCSTFSNHTVLPEIALAKINPDAPFDKVCYIGCGVTTGIGAVI
NTAKVEIGSRAIVFGLGGIGLNVIQGLRLAGADQIVGVDLNPDKVEMATRFGMTDFVNPK
DVEGDLVPYLVDLTKGGADYTFDATGNVGVMRTALEAAHKGWGESIIIGVAPAGAEISTR
PFQLVTGRVWKGTAFGGARGRTDVPKIVDWYMQGKIEIDPMITHTLTLDEINKGFDLMHA
GESIRSVVVY
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcggacaaaagcggcggtggcgctggaagcgggcaagcccctggaggtaatggaagtg
aacctcgaaggtccgaaggcgggcgaggtcctggtcgagatcaaggcgacgggcatctgc
cacacggacgaattcaccctgtcgggcgccgatccggaggggctgttccccgccatcctc
ggccacgaaggcgcaggcgtggtgctcgaggtgggcccgggcgtgacctcgctgaagccg
ggcgatcacgtgatcccgctttacacccccgaatgccgccagtgcgaatactgcctcaac
cccaagaccaacctctgccaggccatccggaccacgcagggacagggcctgatgccggac
ggcacctcgcgcttctcgatgctcgatggcacgccgatcctgcactacatgggctgttcg
accttctcgaaccacaccgtcctgccggagatcgcgctggcaaagatcaacccggacgcg
cctttcgacaaggtctgctacatcggctgcggcgtgaccacgggcatcggcgcggtcatc
aacaccgccaaggtggagatcgggtcgcgcgccatcgtcttcggcctgggcgggatcggc
ctgaacgtgatccagggcctgcggctggcgggcgcggaccagatcgtcggcgtcgacctg
aaccccgacaaggtcgagatggcgacgcgcttcggcatgaccgatttcgtcaacccgaag
gacgtggagggcgacctcgttccctacctcgtggacctgaccaaaggcggtgcggattac
accttcgacgcgacgggcaacgtgggcgtgatgcgcaccgcgctggaagcggcccacaag
ggctggggtgaatcgatcatcatcggcgtggcgccggctggggccgagatcagcacccgt
cccttccagcttgtcaccgggcgggtctggaaaggcaccgcgttcggcggcgcgcgcggg
cgcacggatgtcccgaagatcgtcgactggtacatgcagggcaagatcgagatcgatccg
atgatcacccacacgctgaccctcgacgagatcaacaagggcttcgacctgatgcacgcg
ggcgagtcgatccgttcggtcgtggtctactga

DBGET integrated database retrieval system