KEGG   Sagittula sp. P11: CDO87_10775Help
Entry
CDO87_10775       CDS       T05219                                 

Gene name
ggt
Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
sagu  Sagittula sp. P11
Pathway
sagu00430  Taurine and hypotaurine metabolism
sagu00460  Cyanoamino acid metabolism
sagu00480  Glutathione metabolism
sagu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sagu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CDO87_10775 (ggt)
   00460 Cyanoamino acid metabolism
    CDO87_10775 (ggt)
   00480 Glutathione metabolism
    CDO87_10775 (ggt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sagu01002]
    CDO87_10775 (ggt)
Enzymes [BR:sagu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     CDO87_10775 (ggt)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     CDO87_10775 (ggt)
Peptidases and inhibitors [BR:sagu01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   CDO87_10775 (ggt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AUC53644
UniProt: A0A2K8WBG3
Position
2205593..2207380
Genome map
AA seq 595 aa AA seqDB search
MRMSGWVALLSVMAGTAMAQQAADAVDAEAETGGTTGFAAISEEVGAALAAKEAGEPVTA
SKWMVAAANPHAVSAGAEVLRNGGTAADAMIAVQTVLGLVEPQSSGMGGGAFLVWHDGET
GEITTLDGRETAPLDATPLLFQDEAGEPLGFWDAVVGGRSVGVPGTPALMQAAHDKWGKA
EWAGLFDAATKLAEDGFEVSPRLAALVAEDPLKLTRQEVAASYFFPDGEPVAAGTTLTNP
DYAEVMKTLAAEGAKGFYEGEIAQGIVDTVTGFTDNPGVMSLLDLALYEVKERPAVCAEF
RDHEVCGMGPPSSGALTVGQILGMLDASEPGAADDPDTWRKIGDASRLAFADRGRYMADS
DFVPMPTKGLVDPAYLAERAKLLQGDDALPEVAPGAPEWDHAMLYADDESIEFPSTSHIS
IVDQYGNALSMTTTIENGFGSRLMTNGFLLNNELTDFSFRSHDGGVPIANRVEPGKRPRS
SMSPTIVRKDGAPVLVIGSPGGSRIIGYTAQAIIAFIDWGMDVQQAVAMPHGLNRFGTFD
LEEGTDMAGMQDALTEMGFEVSVQGLTSGLHAIAVAADGLTGGADPRREGIALGE
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatgtcaggatgggtggcactgttgagtgtcatggccgggacggcgatggcgcaa
caggcggcggatgcagtggacgcagaggcggaaaccggaggaacgacaggtttcgccgca
atctccgaagaggtcggcgcggcgctggcggccaaggaggcgggcgagcccgtgacggcg
tcgaagtggatggtcgcggcggccaacccgcatgcggtgtccgcaggcgccgaggtgctg
cgcaacggcggcacggcggcggacgcgatgatcgccgtgcagacggtgctggggctggtg
gagccgcagtcctccggcatggggggcggcgcgttcctcgtctggcacgatggcgagacg
ggcgagatcacgacgctcgacgggcgcgaaaccgcgccgctggacgcgacgccgctgctg
ttccaggacgaggcgggcgagccgctgggcttctgggacgctgtggtcggcggccggtcg
gtcggtgtgccgggcacacccgccctgatgcaggccgcgcatgacaaatggggcaaggcg
gagtgggccggcctgttcgacgcagccacgaagctggcagaggacgggttcgaagtctct
ccgcgcctcgccgcgctggtggccgaggatccgctgaagctgacacggcaggaggttgcg
gcctcctatttcttcccggacggcgaacccgtcgcggcgggcacgacgctgaccaacccg
gattacgccgaagtcatgaagaccctcgcggcggagggcgcgaaggggttttacgaaggt
gagatcgcgcagggcatcgtcgacaccgtcaccggattcaccgacaatcccggcgtgatg
tccctgctcgaccttgcgctttacgaggtgaaagagcggcctgcggtctgtgcggagttc
cgcgatcacgaggtctgcggcatgggtcctccgtcctccggtgcgctgaccgtgggccag
atcctcgggatgctcgacgcgtcggagccgggcgcagcagacgatccggacacgtggcgc
aagatcggcgatgcctcgcgtctcgccttcgcggaccgtggccgctacatggccgacagc
gatttcgtcccgatgccgaccaagggccttgtcgatcccgcctacctcgccgaacgcgcc
aagctgctgcagggcgacgacgcgctgccggaggtcgccccgggtgcgccggagtgggat
cacgccatgctctacgccgatgacgagagcatcgagttcccgtcgacctcgcacatctcc
atcgtcgaccagtacggcaacgcgctgtcgatgacgacgaccatcgagaacggtttcggc
tcgcgcctgatgacgaacggcttcctgctgaacaacgaactgacggacttctccttccgg
tcgcatgacggcggtgtgccgattgccaaccgggttgagccgggcaagcggccgcgctcc
tccatgagcccgaccatcgtgcgcaaggacggtgcgccggtgctggtgatcggctcgccc
ggcgggtcgcggatcatcggttacaccgcgcaggcgatcatcgcattcatcgactggggg
atggacgttcaacaggcggttgccatgccgcacgggctgaaccgtttcggcaccttcgat
ctggaggaagggaccgacatggccgggatgcaggacgccctgacggagatggggttcgag
gtcagcgtgcagggtctgacctcgggccttcatgccattgccgtggcggctgacgggctg
accggcggtgccgatccccggcgcgaaggcatcgccctgggcgaatga

DBGET integrated database retrieval system