KEGG   Sagittula sp. P11: CDO87_13420Help
Entry
CDO87_13420       CDS       T05219                                 

Definition
(GenBank) trans-aconitate methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
sagu  Sagittula sp. P11
Brite
KEGG Orthology (KO) [BR:sagu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CDO87_13420
Enzymes [BR:sagu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     CDO87_13420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_12 MTS FtsJ Methyltransf_17 Methyltransf_32 Ubie_methyltran PCMT
Motif
Other DBs
NCBI-ProteinID: AUC54112
UniProt: A0A2K8WCU4
Position
2776769..2777542
Genome map
AA seq 257 aa AA seqDB search
MNGADGMIWDPGIYGRFRGLRLRPALDLLRSLPSLPEGPVVDLGCGAGAVSEALRATLGK
DRQLVGVDASAEMLADARGRYDDLVQADIATWQPETPPALIFSNAALQWLGDHEVLLPRL
AATLTPGGVLAVQMPHQNDAPSHRTWLHLAHQLFGVEPDDVPGILEPAAYHHILAPLGEV
QLWETTYFQVLAPSDDGHPVRRFTEATFARPLLRSLDPERRAALIAACDAAMAGAYPASE
DGSVLFPFQRLFFTVRV
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtgccgatggcatgatttgggaccccgggatctatggcagattccggggtctt
cgtttgcggcccgcgcttgacttgctgcgctccttgccgtcgctgcccgaggggcccgtc
gtggacctcggatgcggtgcgggggccgtatcggaggcgttgagggcgacgcttggcaag
gaccggcaactggtcggcgtggatgcctcggccgagatgctggccgatgcgcgcggacgc
tacgacgacctcgtgcaggcggacatcgcgacgtggcagcccgagacgccgccggcgctg
atcttttccaacgccgccctgcaatggctgggcgatcacgaagttctgttgccccggctc
gcggcgacgctcacgccgggcggggtgctggcggtgcagatgccccaccagaacgatgcg
ccgtcgcaccggacgtggctccacctcgcccaccaactgttcggcgtcgaaccggacgac
gtgcccggcatcctcgaacccgctgcctatcatcacattctggcgccgttgggggaggtc
cagttgtgggaaacgacctatttccaggtgctggcgccctcggatgacggccacccggtg
cgccgcttcacggaggcgacctttgcccggccgctgcttcggtcgcttgatcccgaaagg
cgggccgccctgatcgccgcctgcgatgccgccatggcgggcgcctatcccgcgtctgag
gacggcagcgtcctcttccctttccaaaggctgttcttcaccgtccgcgtatga

DBGET integrated database retrieval system