KEGG   Sagittula sp. P11: CDO87_13430Help
Entry
CDO87_13430       CDS       T05219                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
sagu  Sagittula sp. P11
Pathway
sagu00670  One carbon pool by folate
sagu01100  Metabolic pathways
sagu01120  Microbial metabolism in diverse environments
sagu01200  Carbon metabolism
Module
sagu_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:sagu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CDO87_13430
Enzymes [BR:sagu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     CDO87_13430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: AUC54114
UniProt: A0A2K8WCT8
Position
2778512..2780188
Genome map
AA seq 558 aa AA seqDB search
MAHKSDIEIAREARKKPIQEIGDVLGIPNEHLLPYGHDKAKIGQAFIDSVQSRPDGKLIL
VTAINPTPAGEGKTTTTVGLGDGLNRIGKKAMICIREASLGPNFGMKGGAAGGGYAQVVP
MEEMNLHFTGDFHAITSAHSLLSAMIDNHIYWGNEAEIDQRRVTWRRVVDMNDRSLRQIT
SSLGGVANGFPREDGFDITVASEVMAILCLAKNLKDLENRLGDMIVAYRRDRSPVFCRDI
KAEGAMTVLLKDAMQPNLVQTLENNPAFVHGGPFANIAHGCNSVIATTTALKLADYVVTE
AGFGADLGAEKFMDIKCRKAGLRPDAVVIVATVRAMKMNGGVAKADLGTENVQAVKDGCP
NLGRHIENMKKFGVPAVVGINHFVTDTDAEVQAVVDYCASLGVDAILNKHWAEGGAGIEE
TARKVVELCEGGSANYAPLYGDALPLAEKIETVCKEIYRADGVVMDAKIRGQLKEWEDQG
YGHLPVCMAKTQYSFSTDPGQRGAPTGFDIPVREVRLSAGAGFVVVVCGEIMTMPGLPRV
PAAESIRLNADGLIEGLF
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggcccacaagtcggacatcgaaatcgcccgtgaagcccggaagaaaccgatacaggag
atcggcgacgtccttggtatccccaacgagcacctgctgccctacggccacgacaaggcg
aagatcggtcaggctttcatcgattccgtccagtcgcggcccgatggcaagctgatcctt
gtgacggcgatcaacccgacccccgcgggtgaaggcaagaccaccaccaccgtgggactg
ggcgacgggctgaaccgcatcggcaagaaggcgatgatctgcatccgcgaagcctcgctc
gggccgaacttcgggatgaagggcggggcggccgggggcggatacgcgcaggtcgtgccg
atggaggagatgaacctccacttcaccggcgacttccatgcgatcacctcggcgcattct
ctgctgtcggcgatgatcgacaaccacatctactggggcaacgaggccgagatcgaccag
cgccgggtgacatggcgccgggtggtggacatgaacgaccgctcgctgcgccagatcacc
tcttccctcggcggggtggccaacgggttcccgcgcgaggacggtttcgacatcaccgtg
gcgtccgaggtcatggcgatcctctgcctcgccaagaacctgaaggacctggaaaatcgg
ctgggtgacatgatcgtggcgtatcggcgtgacaggtcgccggtcttctgccgcgacatc
aaggccgaaggtgcgatgaccgtcctgctgaaggacgcgatgcagccgaacctcgtccag
acgctggagaacaacccggccttcgtgcatggcggcccgttcgccaacatcgcgcatggc
tgcaactccgtcatcgccacgacgacggcgctgaagctggcggattacgtggtgacggag
gccgggttcggcgcggacctgggggccgagaagttcatggacatcaagtgccgcaaggcc
gggctgcgccccgacgcggtggttatcgtcgccacggtgcgtgcgatgaagatgaacggt
ggtgtcgccaaggcggaccttggcactgagaacgtgcaggcggtgaaagacgggtgcccg
aacctcggccgtcatatcgagaacatgaagaagttcggcgtgccggcggtggtggggatc
aatcatttcgtcaccgacaccgatgccgaagtgcaggcggtcgtcgactactgcgcgtcg
ctgggcgtggacgcgatcctcaacaagcactgggccgagggcggcgcgggcatcgaggag
accgcgagaaaggtcgtcgagctctgcgagggcgggtcggccaactacgcgccgctttat
ggcgatgcgctgccgctggccgagaagatcgaaacggtctgcaaggagatttaccgcgcg
gatggcgtggtgatggacgcgaagatccgcggccaactaaaggagtgggaagaccaaggc
tacggtcacctcccggtctgtatggcgaagacgcaatactcgttctcgaccgatccgggc
cagcgcggcgcgccgaccggcttcgacatcccggtgcgggaagtgcggctgtcggcgggg
gcgggctttgtcgtggtggtctgcggcgagatcatgaccatgcccggcctgccgcgcgtg
cctgccgcggaatcgatccgcctgaacgcggacgggctgattgagggtcttttctga

DBGET integrated database retrieval system