KEGG   Sagittula sp. P11: CDO87_16650Help
Entry
CDO87_16650       CDS       T05219                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
sagu  Sagittula sp. P11
Pathway
sagu00350  Tyrosine metabolism
sagu00360  Phenylalanine metabolism
sagu00380  Tryptophan metabolism
sagu01100  Metabolic pathways
sagu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sagu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CDO87_16650
   00360 Phenylalanine metabolism
    CDO87_16650
   00380 Tryptophan metabolism
    CDO87_16650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sagu04147]
    CDO87_16650
Enzymes [BR:sagu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     CDO87_16650
    4.1.1.105  L-tryptophan decarboxylase
     CDO87_16650
Exosome [BR:sagu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CDO87_16650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AUC54701
UniProt: A0A2K8WED0
Position
3415152..3416546
Genome map
AA seq 464 aa AA seqDB search
MDWDEFARWGAQAAAFGADYHKTLRDRPVRPDVQPGEAAALLEAAPPEAGEGMEAIWEDF
LRVVPERLTHWQHPRFFAYFPANAAPPSMLAEMLVTVMAPQCMLWQTSPVATEMEGVMVQ
WLRQAVGLPEGWSGVIQDSASSATLSAVLTMRERATGWSGNREGLAGKGSLRIYCSGQAH
SSIDRACWVAGIGQENLVKLPDVGAPSYGVDAAALRAAIAADRAAGHVPAGIIAITGGTG
IGAWDDLSAVGAVAREEGLYLHLDAAWGGAAMICPEIREAMWPGVEACDSIVFNPHKWLG
AQFDCSVQFLKDPRQQIDTLKIEPEYLRTSGSEVVNYSEWTIPLGRRFRALKLWFMLRYY
GLEGLRARIRNHVAWSGEVCEALRAQGFEIVTEPILSLFTFRGPGDDAAQQALVDAINSD
GRIYVTQGMFAGRKVVRFQVGQFDCTRDDVMMAADVIREISERM
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggattgggatgaatttgcgcgctggggcgcgcaggcggcggctttcggggccgactat
cacaagacgctcagggaccggccggtgcggccggatgtgcagcccggggaggcggcggcc
ttgctggaggcggccccgcccgaggccggcgaaggcatggaggcgatctgggaggatttc
ctgcgcgtcgtgcccgagcgcctgacgcattggcagcatccccggttcttcgcctacttc
ccggccaatgccgcgccaccctcgatgctggcggagatgctggtcacggtgatggcgccg
cagtgtatgctgtggcagacctcgccggttgcgaccgagatggaaggcgtcatggtccag
tggttgcgacaggcggtgggcctgccggagggctggtccggggtgatccaggattcggcc
tcgtcggccacgctgtcggctgttctgaccatgcgggagagggcgacgggctggtcgggt
aaccgcgaggggctggcgggcaaggggtctttgcggatctattgttcgggacaggcgcat
tcctccatcgaccgggcctgctgggtggcgggcatcgggcaggagaacctcgtgaagctg
cccgatgttggcgcgccatcctatggcgtggatgctgccgcgctgcgggcggccatcgcg
gcggaccgggcggcgggccatgtgccggcgggcatcatcgcgatcaccggcggcacaggc
atcggcgcctgggacgacctgtcggccgtgggcgctgtggcgcgggaggaggggctgtac
ctgcacctcgacgcggcgtggggcggggcggcgatgatctgcccggaaatccgcgaggcg
atgtggccgggggtggaggcctgcgacagcatcgtgttcaacccgcacaagtggctgggc
gcgcagttcgactgctccgtacagttcctgaaggacccgcgccagcagatcgacacgctg
aagatcgagccggagtacctcaggacctccggctcggaggtggtgaactattcggaatgg
acgatcccgctggggcgccggttccgggcgctcaagctttggttcatgctgcggtactac
ggtctggaagggctgcgggcgcgcatccgcaaccacgtcgcctggtctggtgaggtctgc
gaggcgctgcgggcgcagggcttcgagatcgtgacggagccgatcctgtcgctcttcacc
ttccgcgggccgggggacgatgcggcacaacaggcgctggtggatgcgatcaactcggac
gggcggatctatgtcacgcagggcatgttcgccgggcgcaaggtggtgcgcttccaggtc
ggccagttcgactgcacgcgcgacgacgtgatgatggcggcggacgtgatccgcgagatt
tcggagaggatgtga

DBGET integrated database retrieval system