KEGG   Sagittula sp. P11: CDO87_21410Help
Entry
CDO87_21410       CDS       T05219                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sagu  Sagittula sp. P11
Pathway
sagu00020  Citrate cycle (TCA cycle)
sagu00480  Glutathione metabolism
sagu01100  Metabolic pathways
sagu01110  Biosynthesis of secondary metabolites
sagu01120  Microbial metabolism in diverse environments
sagu01130  Biosynthesis of antibiotics
sagu01200  Carbon metabolism
sagu01210  2-Oxocarboxylic acid metabolism
sagu01230  Biosynthesis of amino acids
Module
sagu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sagu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sagu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CDO87_21410
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CDO87_21410
Enzymes [BR:sagu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CDO87_21410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh DUF1706
Motif
Other DBs
NCBI-ProteinID: AUC55557
UniProt: A0A2K8WGX2
Position
4485222..4486436
Genome map
AA seq 404 aa AA seqDB search
MTRIKVDNPIVEMDGDEMTRIMWAFIKEKLILPYLDLDLLYYDLGIEERDRTDDQVTIDA
AEKTKEVGVAVKCATITPDEQRVEEFGLKKMWKSPNGTIRNILGGVVFRQPIICRNVPRL
VPGWTSPIVVGRHAFGDQYKATDFHFPSAGKLTMKWEGANGEVIEREVYDAPGAGVYMGM
YNQDESIRDFARASLNYGLTLGWPVYLSTKNTILKAYDGRFKDLFQEIYEAEFAEKFKEA
GIWYEHRLIDDMVACALKWNGKFVWACKNYDGDVQSDTVAQGFGSLGMMTSQLMTPDGRI
VEAEAAHGTVTRHYRQHQKGEATSTNSIASIYAWTGGLKHRAKLDDNVALRAFAETLERV
IVETVEAGFMTKDLALLVGPDQGWLTTMGFLEKVDERLNKALMG
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtatcaaggtcgacaacccgatcgtggaaatggacggcgacgagatgacccgc
atcatgtgggccttcatcaaggaaaagctgatcctgccgtacctcgacctggacctgctg
tactacgacctggggatcgaggagcgcgacaggaccgacgaccaggtgaccatcgacgcc
gccgagaagaccaaggaggtgggcgtcgcggtcaaatgcgcgacgatcaccccggacgag
cagcgggtcgaggaattcggcctgaagaagatgtggaagtcgcccaacggcacgatccgc
aacatcctgggcggcgtggtcttccgccagccgatcatctgccgcaacgtgccgcggctg
gtgccgggctggacctcgcccatcgtggtgggccgccatgccttcggcgaccagtacaag
gcgacggatttccatttcccctcggccggcaagctgacgatgaaatgggaaggcgcgaac
ggcgaggtgatcgagcgcgaggtctacgatgcgcccggcgccggggtctacatgggcatg
tacaaccaggacgagtcgatccgcgactttgcccgggcgtcgctgaactacggtctgacg
ctgggctggccggtgtacctgtcgaccaagaacaccatcctcaaggcctatgacgggcgg
ttcaaggacctcttccaggagatctacgaggccgagttcgccgagaagttcaaggaagcg
ggcatctggtacgagcaccggctgatcgacgacatggtggcctgcgcgctgaagtggaac
ggcaagttcgtctgggcctgcaagaactacgacggcgacgtgcagtcggacacggtggcg
cagggattcggctcgctcgggatgatgacctcgcagctgatgacgccggacggccggatc
gtcgaggcggaggcggcgcatggcacggtgacgcggcactaccgccagcaccagaagggc
gaggcgacctccaccaactccatcgcgtcgatctatgcctggaccggcgggctgaagcac
cgcgcgaagctggacgacaacgtggcgctgcgggcgtttgccgagacgctggagcgggtg
atcgtcgagacggtcgaggccgggttcatgaccaaggacctcgcgctgcttgtgggcccg
gaccagggctggctgacaacgatgggtttcctcgagaaggtcgacgagcgtctgaacaag
gcgctgatgggctga

DBGET integrated database retrieval system