KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_0403
Entry
SaurJH1_0403      CDS       T00556                                 

Name
(GenBank) high-affinity iron transporter
  KO
K07243  high-affinity iron transporter
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
Brite
KEGG Orthology (KO) [BR:sah00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sah02000]
    SaurJH1_0403
Transporters [BR:sah02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   SaurJH1_0403
SSDB
Motif
Pfam: FTR1 MNHE
Other DBs
NCBI-ProteinID: ABR51265
Position
427875..429587
AA seq 570 aa
MKHYLTKFVAMLITAAMVCSFGLLKSQAAEQQSISDVYSVITDAKSALSNNSISNDNKQK
AIEQVVSAVKKLSLEDNSEGNAVKSDVRKLEDAKANDNQKDTLSQLTKSLIAYEEKLASK
DAGSKIKLLQQQVDAKDAAMTKAIKDKNKAELESLNNSLNQIWTSNETVIRNYDANQYGQ
IEVALLQLRIAIHKSPLDTAKVSHAWTTFKSNIDHVDKKSDTSANDQYHVSQLNDALEKA
IKAIDDNQLSDADAALTHFIEIWPYVEGQIQTKDGALYTKIEDKIPYYQSVLDEHNKSHV
KDGLVDINNQIKEVVGHSYSFVDVMIIFLREGLEVLLIVMTLTTMTRKVKDNKGTASVIG
GAIAGLVLSIILAITFVETLGNSGILRESMEAGLGIVAVILMFIVGVWMHKRSNAKRWND
MIKNMYANAISNGNLVLLATIGLISVLREGVEVIIFYMGMIGELATKDFIIGIALAIVIL
IVFAVLFRFIVRLIPIFYIFRVLSIFIFIMGFKMLGVSIQKLQLLGAMPRHVIEGFPTIN
WLGFYPSYEPLIAQAAYIMVVAILIFKFKK
NT seq 1713 nt   +upstreamnt  +downstreamnt
gtgaaacattatttgactaaatttgtagcaatgctaataactgctgctatggtgtgtagc
tttgggttactgaaaagtcaggcagcagaacaacaaagtattagtgatgtatatagtgtg
ataacggatgcgaaatctgcactttctaataattcgatatcgaatgacaataagcagaaa
gcaattgagcaagtggtaagtgcagttaagaaattatcgcttgaagataatagtgaaggt
aatgctgtcaaatcagatgtgagaaagcttgaagatgcaaaagcgaatgataatcaaaaa
gatacactttcgcaattaacgaagtcattaattgcttatgaagagaaattggctagtaaa
gatgcgggttctaaaattaaactattgcaacagcaagtcgatgccaaagatgctgcgatg
acaaaagcgattaaagataaaaataaagcggaattagaatctttgaacaatagtttgaat
cagatttggacaagtaatgaaacagtgattcgcaattatgacgcaaatcaatatggacaa
attgaagtcgcattattacaacttagaattgcaattcataagtcaccattagatacggca
aaagtgtcacatgcttggacaacttttaaatcaaatattgatcatgtcgataaaaaaagt
gatacgtctgcaaatgatcaataccatgtatcacaattaaatgatgcgttagagaaggcg
attaaagctatcgacgacaatcaattgtcggatgctgatgctgcgcttacacattttata
gaaatttggccgtatgttgaaggtcaaattcaaactaaagacggggctttgtatacgaaa
attgaagataaaataccatattatcaaagtgtattagacgaacataataaatcgcatgtc
aaagatggtttagtagatataaacaatcaaattaaagaggttgttggccatagttatagc
tttgtcgatgtgatgattatctttttacgtgaaggactagaagtgttattaattgtaatg
acattgactaccatgacgcgtaaagtcaaagataataaggggactgcaagtgtgattggt
ggtgcaattgccggacttgtactgagtattatcttagcaattacgtttgtagaaacttta
gggaatagtggcattcttcgtgaaagtatggaagcgggattaggtatcgttgcggtcata
ttaatgtttatcgttggtgtttggatgcacaaacgttcaaatgcgaaacgctggaatgat
atgattaaaaatatgtatgccaatgcgattagtaatggtaatttggtattgttagcgacg
attggtttaatatctgtgttgcgtgaaggtgttgaggttatcattttctatatggggatg
ataggtgagctagcgacaaaagattttattattggtattgccttggccatagtgatatta
attgtctttgcggtattatttagatttatcgtcagattgatacctatattctatatattt
agagtattgtcgatctttatttttattatgggattcaaaatgcttggcgtaagtattcaa
aagttacaattattaggtgcgatgccaagacatgttattgaaggattcccaacgattaac
tggttgggcttctatccaagttatgaaccattgatagcacaagctgcttatattatggta
gttgctatcttaatctttaaatttaaaaaataa

DBGET integrated database retrieval system