KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_0577
Entry
SaurJH1_0577      CDS       T00556                                 

Definition
(GenBank) ribosomal protein L7/L12
  KO
K02935  large subunit ribosomal protein L7/L12
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
Pathway
sah03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sah00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SaurJH1_0577
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sah03011]
    SaurJH1_0577
Ribosome [BR:sah03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SaurJH1_0577
  Bacteria
    SaurJH1_0577
SSDB
Motif
Pfam: Ribosomal_L12 Ribosomal_L12_N Bac_DNA_binding DUF2267 CwsA PP2C_C
Other DBs
NCBI-ProteinID: ABR51435
UniProt: A6TZ17
Position
618653..619021
AA seq 122 aa
MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVEL
TSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVE
LK
NT seq 369 nt   +upstreamnt  +downstreamnt
atggctaatcatgaacaaatcattgaagcgattaaagaaatgtcagtattagaattaaac
gacttagtaaaagcaattgaagaagaatttggtgtaactgcagctgctccagtagcagta
gcaggtgcagctggtggcgctgacgctgcagcagaaaaaactgaatttgacgttgagtta
acttcagctggttcatctaaaatcaaagttgttaaagctgttaaagaagcaactggttta
ggattaaaagatgctaaagaattagtagacggagctcctaaagtaatcaaagaagcttta
cctaaagaagaagctgaaaaacttaaagaacaattagaagaagttggagctactgtagaa
ttaaaataa

DBGET integrated database retrieval system