KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_1134
Entry
SaurJH1_1134      CDS       T00556                                 

Name
(GenBank) conserved hypothetical protein
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
SSDB
Other DBs
NCBI-ProteinID: ABR51988
Position
1150678..1150788
AA seq 36 aa
MSLCTQQKLNHELQAKVAVIVKIDGKQSPLFLLVYV
NT seq 111 nt   +upstreamnt  +downstreamnt
gtgtcattgtgcacacaacaaaaattgaatcatgaattacaagcaaaagtagcggtgatt
gttaaaattgatggtaaacaatcaccgctatttttgcttgtgtatgtataa

DBGET integrated database retrieval system