KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_1660
Entry
SaurJH1_1660      CDS       T00556                                 

Definition
(GenBank) cytidine deaminase
  KO
K01489  cytidine deaminase [EC:3.5.4.5]
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
Pathway
sah00240  Pyrimidine metabolism
sah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sah00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SaurJH1_1660
Enzymes [BR:sah01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.5  cytidine deaminase
     SaurJH1_1660
SSDB
Motif
Pfam: dCMP_cyt_deam_1 dCMP_cyt_deam_2 LmjF365940-deam ADH_N DUF2685
Other DBs
NCBI-ProteinID: ABR52508
Position
complement(1728245..1728649)
AA seq 134 aa
MSYQPHYFQEVRKAQQESYSPYSQFKVGAYLKTKDGRTFYGTNVENASYPLSICAERASL
VSAISQGYRPGDFESITVTVDADKPSSPCGACRQVLKELCDDDMPVYMTNHKGDMVMMTV
AELLPFGFSGKDLE
NT seq 405 nt   +upstreamnt  +downstreamnt
atgagttatcaacctcattattttcaagaagttagaaaagcacaacaagaatcatattcg
ccatacagtcaatttaaagtaggggcttatttaaaaacgaaagacggtagaactttttat
ggtaccaatgtagaaaatgcttcttatccattatcgatatgtgctgaacgagctagtttg
gtatcggcaatttctcaaggatacagaccaggtgattttgaatcaataactgtaaccgta
gatgcagataaaccgtcatcaccttgtggtgcatgtcgtcaagttttaaaggaattatgt
gatgatgatatgcctgtgtatatgacaaatcataaaggagatatggttatgatgacagtc
gcagagttactaccatttggattttcaggaaaggatttagaataa

DBGET integrated database retrieval system