KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_2382
Entry
SaurJH1_2382      CDS       T00556                                 

Name
(GenBank) helix-turn-helix protein RpiR
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
SSDB
Motif
Pfam: HTH_6 SIS SIS_2 DUF2529 HTH_Crp_2 FleQ Med25
Other DBs
NCBI-ProteinID: ABR53207
Position
2470157..2471029
AA seq 290 aa
MSNVLTEIDSQYPYMTKNEKKIAKFILNSPQKVIKMRSQDLASLLDISTSSVIRFSKKIT
DGGFHDLKINISKYVPKASSIYNVELMNNESTESLRTKLHTRTTRALNHANNELNDKTID
QICHCLKRSETIFIYGFGASFVVATDLYQKLSRIGLNIQLVQETHIFATLLATHNSNDSV
ILITNNGTQSEMQSMVKVIDDYHIPIITITSTRDNPVAQASNIVLTYGKTDENEMHMGAT
TSLFAQMFTIDILYYRYVALNYHASLDFITQSKMALDNYRKHLSNINFKH
NT seq 873 nt   +upstreamnt  +downstreamnt
atgtcaaacgtactaacagaaatagatagtcaatatccatatatgactaaaaatgaaaaa
aagatagctaaatttatactaaattcacctcaaaaggtgattaaaatgaggtctcaagac
ttagcaagcttattagatattagtacatcatcagtcattcgattcagcaagaaaattact
gatggcggttttcacgacttgaaaataaatatatctaaatatgttcctaaagcatcatca
atttacaatgttgaattaatgaataacgaaagcacagaatctttaagaactaaactccat
acacgtactacacgcgcacttaatcatgcaaataacgaattaaatgataaaactattgat
caaatatgtcattgtttaaaacgttctgagacgatttttatatatggttttggcgcatct
tttgtagttgctaccgacttataccaaaagttatcaagaataggtcttaatattcaactt
gttcaagaaacacatatttttgctacattattagcaactcacaattcgaacgacagtgtt
attcttattactaacaatggtacgcaaagtgaaatgcaatcaatggttaaagttattgat
gactaccatatacctataattacaattactagtacaagggataatcccgtagcacaggca
tcaaatattgttttaacttatgggaaaactgatgaaaatgagatgcatatgggagcaaca
acttcattatttgctcaaatgttcactattgatattttatattatcgttatgttgcatta
aattatcacgcatcattagatttcataacacaatctaaaatggctttagataactatcgt
aaacatttatcaaatattaactttaaacattaa

DBGET integrated database retrieval system