KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_2425
Entry
SaurJH1_2425      CDS       T00556                                 
Name
(GenBank) drug resistance transporter, Bcr/CflA subfamily
  KO
K07552  MFS transporter, DHA1 family, multidrug resistance protein
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
Brite
KEGG Orthology (KO) [BR:sah00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sah02000]
    SaurJH1_2425
Transporters [BR:sah02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    SaurJH1_2425
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_3
Other DBs
NCBI-ProteinID: ABR53250
Position
complement(2511242..2512450)
AA seq 402 aa
MNDLTHFNKRSPIFIIILGSLTAIGALSIDMFLPGLPDIRHDFQTTTSNAQLTLSMFMIG
LAFGNLFAGPISDSTGRRKPLIIAMIIFTLASLGIVFVHNIWLMVALRFLQGVTGGAAAV
ISRAIASDMYSGNELTKFMALLMLVNGIAPVVAPTIGGIILNYSVWRMVFVILTIFGFVM
VIGSLLKVPESLTVTNRESSSGLKTMFKNFKILLKTPRFVLPMLIQGMTFVILFTYISAS
PFIIQKIYGMTAIQFSWMFAGIGITLIISSQLTGYLVDFIDSQKLMRGMTMIQIIGVILV
TIVLLNHWNFWILAIGFIILIAPVTGVATLGFTIAMDESSSGRGSSSSLLGLVQFLFGGV
ASPLVGVKGEDNPIPYIIIIIATAVILIILQIYNMKVFKTNR
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgaatgatttaacgcattttaacaagcgttcaccgatatttattattattttaggatct
ttgacggccattggagcattatcgatagatatgtttttgcctggattaccagatattaga
catgattttcaaacaacgacgtctaacgcacaattaacattatcgatgtttatgattggt
ttagcgtttggtaatttgtttgctggtccaatttcagattcaactgggcgcagaaagccg
cttattatagctatgattatttttacattagcaagtttaggtattgtttttgtacataat
atttggctgatggttgcattaagatttcttcaaggagtgacaggtggcgcagcagcagtt
atttcaagagctatagcaagtgatatgtatagtggtaatgaactaactaagtttatggca
ttattgatgcttgttaatggtattgcaccagttgttgcgccaacaatagggggcataatt
ttaaattattctgtctggcgtatggtctttgtcattctgactatctttggtttcgtcatg
gtcataggttctttattaaaagtacctgaatcattaacagtgacaaatcgtgagtcaagt
agtggattaaaaacaatgtttaaaaacttcaaaatattattgaagacgccacgttttgta
ttaccaatgctcattcaaggtatgacatttgtaatattatttacttatatttctgcgtct
ccgtttattattcaaaaaatttatggcatgactgcaatacaatttagttggatgtttgca
ggaattggtattacgctcattatatcaagtcaacttactgggtaccttgttgattttata
gactcacaaaaattgatgagaggcatgacgatgattcagattatcggtgtaattttagtg
acgattgtattgcttaatcattggaacttttggattttagcgataggatttatcatttta
atagcaccagtgacaggtgttgcgacacttggttttacaatagctatggatgaaagtagt
agtggtagagggagttcatcaagtttattaggtttagtgcagtttttatttggtggtgtt
gcatcgccattagtgggggtaaaaggtgaagataatcctataccttacataattattatt
atagctacagcagttatattaattattttacagatttataatatgaaggtatttaaaaca
aatcgatga

DBGET integrated database retrieval system