KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_2459
Entry
SaurJH1_2459      CDS       T00556                                 

Name
(GenBank) major facilitator superfamily MFS_1
  KO
K10850  MFS transporter, NNP family, putative nitrate transporter
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
Pathway
sah02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SaurJH1_2459
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sah02000]
    SaurJH1_2459
Transporters [BR:sah02000]
 Major facilitator superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    SaurJH1_2459
SSDB
Motif
Pfam: MFS_1 OATP 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: ABR53284
UniProt: A6U4B6
Position
complement(2545419..2546588)
AA seq 389 aa
MYKTKGGFQLTLQTLSLVVGFMAWSIIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLR
VPFGYLTNIVGAKWVFFTSFIVLLFPIFFLSQAQTPGMLMASGFFLGVGGAIFSVGVTSV
PKYFPKEKVGLANGIYGMGNIGTAVSSFLAPPIAGIIGWQTTVRSYLIIIALFALIMFIF
GDTQERKIKVPLMAQMKTLSKNYKLYYLSYWYFITFGAFVAFGIFLPNYLVNHFGIDKVD
AGIRSGVFIALATFLRPIGGILGDKFNAVKVLMIDFVIMIIGAVILGISDHIALFTVGCL
TISICAGIGNGLIFKLVPSYFSNEAGSANGIVSMMGGLGGFFPPLVITYVANLTGSSHLA
FIFLAVFGCIALFTMRHLYQKEYGSLKHS
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgtacaaaacaaaaggtggctttcaacttacattacaaacattaagtttagtggttggg
tttatggcttggagtataattgcgccattaatgccctttattaaacaagatgtcaatgtt
actgaaggtcaaatatcaatcattttagcgataccagttattttgggatcagtgctccgt
gtgccatttggttatttaacaaatattgttggtgctaaatgggtattctttacaagtttt
atcgtattgttattcccgatatttttcttaagccaagcacaaacgccgggtatgttaatg
gcatcaggatttttccttggcgtaggtggcgcaattttctctgttggtgttacatcagtt
cctaaatatttcccaaaagaaaaagtaggtctagcaaatggtatttatggtatggggaat
atcggtacagcagtttcttcatttttagcaccaccgatagcgggtattattggttggcaa
acaacagttagaagttacttaattattatcgctttatttgcattaattatgttcattttt
ggtgacacacaagaacgtaaaattaaagtgccattaatggcccaaatgaaaacattatct
aaaaactacaaattatattacttaagttattggtatttcattacttttggtgcttttgta
gcatttggtattttcttacctaactacttagtaaatcattttggaattgacaaagtagat
gctggtattcgttcaggtgtattcattgcgctggcaacattcttgagaccaataggtggt
atactaggtgataaatttaatgcagttaaagtactgatgattgattttgttattatgatt
atcggtgccgttattttaggtatttcagaccatatcgcattattcactgtaggctgttta
acaataagtatttgtgcaggtattggtaacggcttaatttttaaattagtaccatcctac
ttctcaaatgaagcaggatcagcaaatggtatcgtatcaatgatgggtggtttaggagga
ttcttcccaccgttggtcatcacatacgtagctaatttaacaggttcaagccatttagca
tttattttcttagcggtatttggatgcattgcattatttaccatgcgccatttatatcaa
aaagaatatggttcattgaaacacagttga

DBGET integrated database retrieval system