KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_2479
Entry
SaurJH1_2479      CDS       T00556                                 

Definition
(GenBank) addiction module toxin, Txe/YoeB family
  KO
K19158  toxin YoeB [EC:3.1.-.-]
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
Brite
KEGG Orthology (KO) [BR:sah00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:sah02048]
    SaurJH1_2479
Enzymes [BR:sah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     SaurJH1_2479
Prokaryotic defense system [BR:sah02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   YoeB-YefM
    SaurJH1_2479
SSDB
Motif
Pfam: YoeB_toxin HigB-like_toxin YafQ_toxin
Other DBs
NCBI-ProteinID: ABR53303
Position
complement(2567079..2567270)
AA seq 63 aa
MVKKINELLKSIDRNGALEGIGKPEKLKSNLTGYYSRRINHEHRLVYTVDDNHIKIASCK
YHY
NT seq 192 nt   +upstreamnt  +downstreamnt
atggtgaagaagattaatgagttacttaaaagtattgacagaaatggtgcattggaaggt
ataggtaagcctgaaaagttaaaatcgaatctgactgggtattatagtagacgtatcaat
cacgaacatagattggtttatacagtagatgacaatcatataaaaatagcatcatgtaaa
taccattattaa

DBGET integrated database retrieval system