KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_2773
Entry
SaurJH1_2773      CDS       T00556                                 

Definition
(GenBank) transcriptional regulator PadR family protein
  KO
K10947  PadR family transcriptional regulator, regulatory protein PadR
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
Brite
KEGG Orthology (KO) [BR:sah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sah03000]
    SaurJH1_2773
Transcription factors [BR:sah03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    SaurJH1_2773
Motif
Pfam: PadR HTH_34 TrmB DUF6429 FUR LexA_DNA_bind
Other DBs
NCBI-ProteinID: ABR53595
Position
complement(2887120..2887458)
AA seq 112 aa
MSVSDQIMKGLLDGAILGLIAQGETYGYEIMTKLKNQEFPEISEGSIYPVLMRLNKKGYV
DTTIKKSSNGGPRRKYYTITDSGLKELKVFKSKWQALNKGMINLFGGENDVN
NT seq 339 nt   +upstreamnt  +downstreamnt
atgtcagtgtcagatcagattatgaaaggtctcttagatggggcgatattaggtctcatt
gcccaaggcgaaacgtatggatatgaaattatgacgaaacttaagaatcaagagtttcca
gagataagtgagggtagtatttatccagttttaatgcgtttaaacaaaaaaggatacgtt
gatacgacaataaaaaaatctagtaatggcggcccgaggcggaaatactatacgattacc
gattcaggtttaaaggaactaaaagtatttaaatcaaaatggcaagctttgaataaaggg
atgattaacttgtttggaggggaaaacgatgttaactaa

DBGET integrated database retrieval system