KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_0412Help
Entry
SaurJH1_0412      CDS       T00556                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
Pathway
sah00071  Fatty acid degradation
sah00072  Synthesis and degradation of ketone bodies
sah00280  Valine, leucine and isoleucine degradation
sah00310  Lysine degradation
sah00362  Benzoate degradation
sah00380  Tryptophan metabolism
sah00620  Pyruvate metabolism
sah00630  Glyoxylate and dicarboxylate metabolism
sah00640  Propanoate metabolism
sah00650  Butanoate metabolism
sah00900  Terpenoid backbone biosynthesis
sah01100  Metabolic pathways
sah01110  Biosynthesis of secondary metabolites
sah01120  Microbial metabolism in diverse environments
sah01130  Biosynthesis of antibiotics
sah01200  Carbon metabolism
sah01212  Fatty acid metabolism
sah02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SaurJH1_0412
   00630 Glyoxylate and dicarboxylate metabolism
    SaurJH1_0412
   00640 Propanoate metabolism
    SaurJH1_0412
   00650 Butanoate metabolism
    SaurJH1_0412
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SaurJH1_0412
   00072 Synthesis and degradation of ketone bodies
    SaurJH1_0412
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SaurJH1_0412
   00310 Lysine degradation
    SaurJH1_0412
   00380 Tryptophan metabolism
    SaurJH1_0412
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SaurJH1_0412
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SaurJH1_0412
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SaurJH1_0412
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sah04147]
    SaurJH1_0412
Enzymes [BR:sah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SaurJH1_0412
Exosome [BR:sah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SaurJH1_0412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: ABR51274
Position
435967..437148
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEIDEVIIGNVLQAG
QGQNPARIAAMKGGLPEKVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQHKAVRAQQNGEFDSEIVPVSIPQRKGEPILVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQLLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattgatgaagttatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaaaagtacct
gcatttacagtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcag
tcaccaatgcttgtcaacaacagtcgcttcggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacataaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatcttagtcactaaggatgaaggtgta
cgtgaaaatgtatcagtcgaaaaattaagtcgcttaagaccagctttcaaaaaagacggg
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggcgtagatccttctattatgggtattgcaccagttggcgctgtagaaaaggct
ttgaaacgtagtaaaaaagaattaagcgatattgatgtatttgaattaaatgaagcattt
gcagcacaattattagctgttgatcgtgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacaccctattggtgcatctggtgctagagttttagtg
acattattgcatcaactgaatgatgaagttgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system