KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_1266Help
Entry
SaurJH1_1266      CDS       T00556                                 

Definition
(GenBank) phospho-N-acetylmuramoyl-pentapeptide-transferase
  KO
K01000  phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
Pathway
sah00550  Peptidoglycan biosynthesis
sah01100  Metabolic pathways
sah01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sah00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SaurJH1_1266
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    SaurJH1_1266
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sah01011]
    SaurJH1_1266
Enzymes [BR:sah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.13  phospho-N-acetylmuramoyl-pentapeptide-transferase
     SaurJH1_1266
Peptidoglycan biosynthesis and degradation proteins [BR:sah01011]
 Precursor biosynthesis
  Glycosyltransferase
   SaurJH1_1266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_4 MraY_sig1
Motif
Other DBs
NCBI-ProteinID: ABR52120
UniProt: A6U102
Position
1285032..1285997
Genome map
AA seq 321 aa AA seqDB search
MIFVYALLALVITFVLVPVLIPTLKRMKFGQSIREEGPQSHMKKTGTPTMGGLTFLLSIV
ITSLVAIIFVDQANPIILLLFVTIGFGLIGFIDDYIIVVKKNNQGLTSKQKFLAQIGIAI
IFFVLSNVFHLVNFSTSIHIPFTNVAIPLSFAYVIFIVFWQVGFSNAVNLTDGLDGLATG
LSIIGFTMYAIMSFVLGETAIGIFCIIMLFALLGFLPYNINPAKVFMGDTGSLALGGIFA
TISIMLNQELSLIFIGLVFVIETLSVMLQVASFKLTGKRIFKMSPIHHHFELIGWSEWKV
VTVFWAVGLISGLIGLWIGVH
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgatttttgtatatgcgttattagcgctagtgattacatttgttttggtacctgtttta
atacctacattaaaaaggatgaaatttggtcaaagtattcgagaagaaggtccacaaagc
catatgaagaagactggtacaccaacgatgggtggactaacatttctattaagtattgtg
ataacgtctttggtggctattatatttgtagatcaagctaatccaatcatactgttatta
tttgtgacgattggttttgggttaattggttttatagatgattatattattgttgttaaa
aagaataaccaaggtttaacaagtaaacagaagtttttggcgcaaattggtattgcgatt
attttctttgttttaagtaatgtgtttcatttggtgaatttttctacgagcatacatatt
ccatttacgaatgtagcaatcccactatcatttgcatatgttattttcattgttttttgg
caagtaggtttttctaatgcggtaaatttaacagatggtttagatggattagcaactgga
ctgtcaattatcggatttacaatgtatgccatcatgagctttgtgttaggagaaacggca
attggtattttctgtatcattatgttgtttgcacttttaggatttttaccatataacatt
aaccctgctaaagtgtttatgggagatacaggtagcttagctttaggtggtatatttgct
acgatttcaatcatgcttaatcaggaattatcattaatttttataggtttagtattcgta
attgaaacattatctgttatgttacaagtcgctagctttaaattgactggaaagcgtata
tttaaaatgagtccgattcatcatcattttgaattgataggatggagcgaatggaaagta
gttacagtattttgggctgttggtctgatttcaggtttaatcggtttatggattggagtg
cattaa

DBGET integrated database retrieval system