KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_1317Help
Entry
SaurJH1_1317      CDS       T00556                                 

Definition
(GenBank) Ribonuclease III
  KO
K03685  ribonuclease III [EC:3.1.26.3]
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
Brite
KEGG Orthology (KO) [BR:sah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:sah03019]
    SaurJH1_1317
   03009 Ribosome biogenesis [BR:sah03009]
    SaurJH1_1317
   03036 Chromosome and associated proteins [BR:sah03036]
    SaurJH1_1317
Enzymes [BR:sah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     SaurJH1_1317
Messenger RNA biogenesis [BR:sah03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     SaurJH1_1317
Ribosome biogenesis [BR:sah03009]
 Eukaryotic Type
  90S particles
   RNase
    SaurJH1_1317
 Prokaryotic Type
  rRNA processing factors
   SaurJH1_1317
Chromosome and associated proteins [BR:sah03036]
 Eukaryotic Type
  RNA silencing
   microRNA pathway
    Microprocessor complex
     SaurJH1_1317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonucleas_3_3 Ribonuclease_3 dsrm
Motif
Other DBs
NCBI-ProteinID: ABR52170
UniProt: A6U152
Position
1340719..1341450
Genome map
AA seq 243 aa AA seqDB search
MSKQKKSEIVNRFRKRFDTKMTELGFTYQNIDLYQQAFSHSSFINDFNMNRLDHNERLEF
LGDAVLELTVSRYLFDKHPNLPEGNLTKMRATIVCEPSLVIFANKIGLNEMILLGKGEEK
TGGRTRPSLISDAFEAFIGALYLDQGLDIVWKFAEKVIFPHVEQNELLGVVDFKTQFQEY
VHQQNKGDVTYNLIKEEGPAHHRLFTSEVILQGEAIAEGKGKTKKESEQRAAESAYKQLK
QIK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacaaaagaaaagtgagatagttaatcgttttagaaagcgctttgatactaaa
atgacagagttaggctttacttatcaaaatattgatttataccaacaagcattttcgcat
tcgagttttattaatgattttaatatgaatcgtttagaccataatgagcgtttagagttt
ttgggtgatgcggtattagaattgacggtttcacgatatttatttgataaacatcccaac
ttgccagaagggaatttaacaaaaatgcgtgccactattgtatgtgagccctcacttgta
atatttgcgaataaaattggattgaacgaaatgattttacttggtaaaggtgaagagaaa
acagggggacgtacaagaccatcattaatatcagatgcattcgaagcatttattggggca
ttgtatttggatcaaggactagatatagtttggaaatttgctgagaaagttattttccca
catgtagaacaaaatgagttattaggcgtggtagattttaaaacacaattccaagaatat
gtgcaccagcaaaataaaggtgatgtaacctataatttaataaaagaagagggaccggca
catcatcgtctattcacttcagaagttattctgcaaggggaagcaatagctgaaggtaaa
gggaaaacgaaaaaagaatcagaacaacgtgctgctgaaagtgcctataagcaattaaaa
caaattaaatag

DBGET integrated database retrieval system