KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_1639Help
Entry
SaurJH1_1639      CDS       T00556                                 

Definition
(GenBank) putative glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
Pathway
sah00010  Glycolysis / Gluconeogenesis
sah00052  Galactose metabolism
sah00500  Starch and sucrose metabolism
sah00520  Amino sugar and nucleotide sugar metabolism
sah00521  Streptomycin biosynthesis
sah01100  Metabolic pathways
sah01110  Biosynthesis of secondary metabolites
sah01120  Microbial metabolism in diverse environments
sah01130  Biosynthesis of antibiotics
sah01200  Carbon metabolism
Module
sah_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sah_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sah00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SaurJH1_1639
   00052 Galactose metabolism
    SaurJH1_1639
   00500 Starch and sucrose metabolism
    SaurJH1_1639
   00520 Amino sugar and nucleotide sugar metabolism
    SaurJH1_1639
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SaurJH1_1639
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SaurJH1_1639
Enzymes [BR:sah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SaurJH1_1639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: ABR52487
Position
complement(1706828..1707814)
Genome map
AA seq 328 aa AA seqDB search
MTKIILAADVGGTTCKLGIFTPELEQLHKWSIHTDTSDSTGYTLLKGIYDSFVEKVNENN
YNFSNVLGVGIGVPGPVDFEKGTVNGAVNLYWPEKVNVREIFEQFVDCPVYVDNDANIAA
LGEKHKGAGEGADDVVAITLGTGLGGGIISNGEIVHGHNGSGAEIGHFRADFDQRFKCNC
GRSGCIETVASATGVVNLINFYYPKLTFRSSILELIKENKVTAKAVFDAAKAGDQFCIFI
TEKVANYIGYLCSIISVTSNPKYIVLGGGMSTAGPILIENIKTEYHNLTFAPAQFETEIV
QAKLGNDAGITGAAGLIKTYVLDKEGVK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattattttagcagctgatgtaggcgggacgacttgtaaattaggtattttc
acacctgaattagaacaattacataaatggtctattcacactgatacatctgatagtaca
ggatatacacttttgaaaggaatttatgattcgtttgttgaaaaagtaaatgaaaataat
tataatttttcaaatgtacttggcgtaggtattggtgtaccaggtcctgttgactttgaa
aaaggtacagtaaatggagcagtaaacttatattggccagaaaaagttaatgtacgtgag
atttttgaacaattcgttgattgtccagtgtatgtagataatgatgctaacatagctgct
ttaggggagaaacacaaaggtgctggtgaaggtgccgatgatgttgttgccatcacactt
ggtacaggtctaggtggaggaattatttcaaatggtgaaatcgtacatggtcataatggc
tctggcgcagaaataggtcattttagagcagacttcgatcaacgatttaaatgtaattgt
ggtcgttctggatgtattgaaacagttgcttcagcgacaggcgttgttaacttaattaac
ttctactatccgaagttgacgtttagatcttctatattagaattgattaaagaaaataag
gttacagcaaaagctgtttttgatgcggcaaaagctggtgaccaattctgtattttcatt
actgaaaaggttgcaaactatattggatatttatgtagtattattagtgttacaagtaat
ccgaaatatatcgttctaggtggaggaatgtctactgcaggacctattttaattgaaaat
attaaaacagaatatcataatttaacatttgcacctgctcaatttgaaactgaaattgta
caagcgaaattaggtaatgatgcaggtattacaggagcagcaggattaatcaagacctat
gtattagataaagagggggtaaaataa

DBGET integrated database retrieval system