KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_1789Help
Entry
SaurJH1_1789      CDS       T00556                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
Pathway
sah00010  Glycolysis / Gluconeogenesis
sah00030  Pentose phosphate pathway
sah00051  Fructose and mannose metabolism
sah00052  Galactose metabolism
sah00680  Methane metabolism
sah01100  Metabolic pathways
sah01110  Biosynthesis of secondary metabolites
sah01120  Microbial metabolism in diverse environments
sah01130  Biosynthesis of antibiotics
sah01200  Carbon metabolism
sah01230  Biosynthesis of amino acids
sah03018  RNA degradation
Module
sah_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sah_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:sah00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SaurJH1_1789
   00030 Pentose phosphate pathway
    SaurJH1_1789
   00051 Fructose and mannose metabolism
    SaurJH1_1789
   00052 Galactose metabolism
    SaurJH1_1789
  Energy metabolism
   00680 Methane metabolism
    SaurJH1_1789
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SaurJH1_1789
Enzymes [BR:sah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SaurJH1_1789
Protein phosphatases and associated proteins [BR:sah01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SaurJH1_1789
Messenger RNA biogenesis [BR:sah03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SaurJH1_1789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABR52633
UniProt: A6U2G5
Position
complement(1860666..1861634)
Genome map
AA seq 322 aa AA seqDB search
MKKIAVLTSGGDSPGMNAAVRAVVRTAIYNEIEVYGVYHGYQGLLNDDIHKLELGSVGDT
IQRGGTFLYSARCPEFKEQEVRKVAIENLRKRGIEGLVVIGGDGSYRGAQRISEECKEIQ
TIGIPGTIDNDINGTDFTIGFDTALNTIIGLVDKIRDTASSHARTFIIEAMGRDCGDLAL
WAGLSVGAETIVVPEVKTDIKEIADKIEQGIKRGKKHSIVLVAEGCMTAQDCQKELSQYI
NVDNRVSVLGHVQRGGSPTGADRVLASRLGGYAVDLLMQGETAKGVGIKNNKIVATSFDE
IFDGKDHKFDYSLYELANKLSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattgcagttttaactagtggtggagattcacctggaatgaatgctgccgta
agagcagttgttcgtacagcaatttacaatgaaattgaagtttatggtgtgtatcatggt
taccaaggattgttaaatgatgatattcataaacttgaattaggatcagttggggatacg
attcagcgtggaggtacattcttgtattcagcaagatgtccagagtttaaggagcaagaa
gtacgtaaagttgcaatcgaaaacttacgtaaaagagggattgagggccttgtagttatt
ggtggtgacggtagttatcgcggtgcacaacgcatcagtgaggaatgcaaagaaattcaa
actatcggtattcctggtacgattgacaatgatatcaatggtactgattttacaattgga
tttgacacagctttaaatacgattattggcttagtcgacaaaattagagatactgcgtca
agtcacgcacgaacatttatcattgaagcaatgggccgtgattgtggagatctagcatta
tgggctggattatcagttggtgctgagacaattgtagttccagaagtgaaaacagatatt
aaagaaatagctgataaaattgaacaaggtattaaacgtggtaagaaacactcaatcgtt
cttgtagcagaaggttgcatgactgcgcaagattgtcaaaaagaattatcacaatacatc
aatgttgataatagagtgtctgtgttaggtcacgttcaacgtggtggtagcccaacaggt
gcggatagagttttagcatcacgtttaggtggatatgcggtagacttattaatgcaaggt
gaaacagctaagggtgttggaattaagaacaataaaattgtagcaacatcttttgatgaa
atttttgatggtaaagatcataaatttgattatagtctatatgaacttgctaacaagtta
tctatataa

DBGET integrated database retrieval system