KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_1878Help
Entry
SaurJH1_1878      CDS       T00556                                 

Definition
(GenBank) Phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
Pathway
sah00010  Glycolysis / Gluconeogenesis
sah00020  Citrate cycle (TCA cycle)
sah00620  Pyruvate metabolism
sah01100  Metabolic pathways
sah01110  Biosynthesis of secondary metabolites
sah01120  Microbial metabolism in diverse environments
sah01130  Biosynthesis of antibiotics
sah01200  Carbon metabolism
Module
sah_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SaurJH1_1878
   00020 Citrate cycle (TCA cycle)
    SaurJH1_1878
   00620 Pyruvate metabolism
    SaurJH1_1878
Enzymes [BR:sah01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     SaurJH1_1878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP PEPCK_GTP AAA_33
Motif
Other DBs
NCBI-ProteinID: ABR52720
UniProt: A6U2Q2
Position
1967779..1969371
Genome map
AA seq 530 aa AA seqDB search
MSVDTYTETTKIDKLLKKPTSHFQLSTTQLYNKILDNNEGVLTELGAVNASTGKYTGRSP
KDKFFVSEPSYRDNIDWGEINQPIDEETFLKLYHKVLDYLDKKDELYVFKGYAGSDKDTM
LKLTVINELAWHNLFAKNMFIRPESKEEATKIKPNFTIVSAPHFKADPEVDGTKSETFVI
ISFKHKVILIGGTEYAGEMKKGIFSVMNYLLPMQDIMSMHCSANVGEKGDVALFFGLSGT
GKTTLSADPHRKLIGDDEHGWNKNGVFNIEGGCYAKAINLSKEKEPQIFDAIKYGAILEN
TVVAEDGSVDFEDNRYTENTRAAYPINHIDNIVVPSKAAHPNTIIFLTADAFGVIPPISK
LNKDQAMYHFLSGFTSKLAGTERGVTEPEPSFSTCFGAPFFPLHPTVYADLLGELIDLHD
VDVYLVNTGWTGGKYGVGRRISLHYTRQMVNQAISGKLKNAEYTKDSTFGLSIPVEIEDV
PKTILNPINAWSDKEKYKAQAEDLIQRFEKNFEKFGEKVEHIAEKGSFNK
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtagacacatacactgaaacaactaaaattgacaaattactgaaaaaaccaacg
tcacattttcaactttcgacgacacaactttataataaaatcttagacaataacgaaggg
gtattaacagaacttggtgctgttaatgcaagtactggaaaatatactggtcgttcgcct
aaagacaaattttttgtctctgaaccttcatatagagataacattgattggggagaaatt
aatcaacctatcgatgaagaaactttcttgaagttataccataaagtactagactattta
gataaaaaagatgaactatacgtatttaaaggctacgctggtagcgataaagatacaatg
ttaaaacttacagtcatcaatgaattagcatggcataatttatttgctaaaaatatgttt
attagacctgaatcaaaagaagaagctacaaagattaaacctaacttcactatcgtttct
gcaccacattttaaagcagatccagaagttgatggtactaaatctgaaacctttgtcatt
atttcatttaaacacaaagtcattttaatcggcggtactgaatacgctggtgaaatgaaa
aaaggtatcttctctgtaatgaattatctcttaccgatgcaagatattatgagcatgcat
tgctcagcaaacgttggtgaaaaaggcgatgttgcattattctttggtctatctggcact
ggtaaaacaaccttatcggctgacccacaccgtaaactaatcggtgatgatgaacacgga
tggaataaaaacggggtctttaatatcgaaggtggctgctatgcaaaagcaattaatctt
tccaaagaaaaagaaccacagatttttgacgcaatcaaatatggtgcaattttagagaac
actgtagttgcagaagatggttcagtggactttgaagacaatcgttatacagaaaacacg
cgtgccgcttatccaattaatcacattgacaatattgtagtaccatcaaaagcagcacat
ccaaatacaattattttcttaactgcggatgcatttggtgttattccaccgatttcaaag
ttaaataaagaccaagcaatgtatcatttcttgagtggtttcacttctaaattagctggt
acagagcgtggtgtgacagaacctgaaccatcattctcaacatgtttcggagcaccgttc
ttcccgttacaccctactgtttacgctgatttattaggtgaacttatcgatttacatgat
gttgatgtttatcttgttaatactggatggactggcggaaaatatggtgtaggacgtaga
atcagcttacattacacacgtcaaatggtaaaccaagcgatttctggcaaattgaaaaat
gcagaatatacaaaagatagtacgtttggtttaagcattcctgtagaaattgaagatgta
ccgaaaacaattttaaatccaattaatgcttggagcgacaaagagaaatataaagcacaa
gcagaagatttaattcaacgttttgaaaagaacttcgaaaaatttggtgaaaaagttgaa
catattgctgaaaaaggtagcttcaacaaataa

DBGET integrated database retrieval system