KEGG   Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA): SaurJH1_2809Help
Entry
SaurJH1_2809      CDS       T00556                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
sah  Staphylococcus aureus subsp. aureus JH1 (MRSA/VSSA)
Pathway
sah00030  Pentose phosphate pathway
sah00480  Glutathione metabolism
sah01100  Metabolic pathways
sah01110  Biosynthesis of secondary metabolites
sah01120  Microbial metabolism in diverse environments
sah01130  Biosynthesis of antibiotics
sah01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SaurJH1_2809
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SaurJH1_2809
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sah04147]
    SaurJH1_2809
Enzymes [BR:sah01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     SaurJH1_2809
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     SaurJH1_2809
Exosome [BR:sah04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SaurJH1_2809
  Exosomal proteins of colorectal cancer cells
   SaurJH1_2809
  Exosomal proteins of bladder cancer cells
   SaurJH1_2809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N PS_pyruv_trans
Motif
Other DBs
NCBI-ProteinID: ABR53628
Position
pSJH101:complement(11228..12688)
Genome map
AA seq 486 aa AA seqDB search
MDKNLSSLITIFGGTGDLSYRKLLPSIFNLYKKGHFKKLVIISTGLEDISDEEYRSKVKQ
ILLSRENFEMVNLFLDNIFYFQQNVEDKTSWNKLKELSNDIDKKYCLDGNRLFYLAMNPQ
FFKIITQSISQSGLSDTNGFSRLIIEKPFGKDLKSAEDLNKHIRQYFKEEEIFRIDHYLG
KEMVQNIESLRFGNTIFEPLWNNKYISNVQITLSETLGIEDRGQYYDSTGALKDMVQNHA
LQILTLIAMEKPESRNSKDIRLKKIELLNNIKFLKGADVHKYFVRGQYINGIINETPIMS
YHEEKGVDSDSTTETFVAGKVLINNRRWEGTPFYIRTGKRLGKKATEIVIEFKKNNNTLR
YENNNEDTDCNLLVINIEPNAKISLYIYENKSNRNNRSHNMKIYNSIDKNQVVDAYESLI
CDALIGNQTNFVHWEELKQSWEFIDYISTEWKKSNVTIPQYKPGSFGPKESDQLLKQDNF
EWWNNL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
ttggataaaaatttatcatcattaataacaatatttggcggaacaggagatttaagttac
aggaaattgctaccttctatttttaatctttataaaaagggtcactttaagaaattagtt
atcatttctacgggtttagaggatataagtgatgaagaatatagaagtaaagtaaaacaa
attttattaagccgagaaaattttgaaatggtgaacttatttttagataacatattttac
tttcaacaaaatgttgaagataaaacaagttggaataaattaaaggaactttccaatgat
attgataaaaaatattgtttggatggcaatagattattttacttagcaatgaatcctcaa
ttttttaaaattataactcaaagcataagccaatcaggtctttctgatacaaatggattt
tcaagattaataatcgaaaaaccatttggaaaagatttgaaatctgctgaagacttaaat
aaacacataagacagtattttaaagaagaagaaatatttagaatagatcattatctaggt
aaagagatggtgcaaaatattgaatctttacgttttggtaatacaatatttgaaccattg
tggaacaacaagtatatatcaaatgttcaaataactctatcggaaactttaggcattgaa
gatagaggccaatactatgattctacaggagcgcttaaagatatggtgcaaaatcatgca
ctacaaatacttactcttattgctatggagaaacccgaaagcagaaatagtaaagatatt
agactaaaaaaaatcgaacttttaaacaatataaaatttttgaaaggggctgatgtacac
aaatattttgttagaggacaatatattaatggtattattaatgaaactccgataatgtca
tatcatgaagaaaaaggtgttgatagtgattcaacaacagaaacatttgtagcaggaaaa
gtacttatcaataatagaagatgggaagggactccattttatattcgtacggggaaacgc
ttaggtaaaaaagcaacagagattgttatagaattcaaaaaaaacaataatacattaaga
tatgaaaataataatgaggatactgattgtaatttactggtaataaatatagaacctaat
gccaaaatatcactatatatttatgaaaataaatcaaatagaaataatagaagtcataat
atgaaaatttataactcaatagataaaaaccaagtagtggatgcttatgaatcacttata
tgtgatgctttaataggaaatcaaactaattttgtacattgggaagaacttaaacaatca
tgggaatttatagattatataagtactgaatggaaaaaatctaacgtaacaataccacag
tataaaccaggaagttttggacctaaagaaagcgatcaattacttaaacaagataacttt
gaatggtggaataatctataa

DBGET integrated database retrieval system