KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0557Help
Entry
Saci_0557         CDS       T00251                                 

Gene name
adh
Definition
(GenBank) NAD-dependent alcohol dehydrogenase
Organism
sai  Sulfolobus acidocaldarius DSM 639
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C NAD_binding_7 Glu_dehyd_C ApbA Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AAY79952
UniProt: Q4JB77
Position
complement(454323..455327)
Genome map
AA seq 334 aa AA seqDB search
MRAAVLEEYKKPLRISEVDSPSINESSEVLLQVTATGLCHGDIHIAMGEWDSQIQVNLPI
ILGHEVVGRVLQSNHDKIKKNDLVLVYNAFGCKNCKYCKFKEYQFCEKVKVIGVNLNGGF
AEYVKIPDGDNLVRVNTSDPIKLAPLADAGLTAYNSVKDLEENSKVLIIGTGAVALIALQ
LLKLKNVDVTVIGENQLKLDSAEKLGADEVISIKREEDSYLSLLPGKKFDYILDYVGSTR
TLAESPWLLNKKGELRIIGEFGGVLRAEEQLLVLRGLRIRGILYGSLQDLKHILDIYLKG
KIDTLTTVYKLEDINEAITDVTEGKVVGRAVIVP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagggcagcagttcttgaagaatataaaaaaccactgagaatatcagaggttgactct
ccttcaataaatgagagctctgaagttttattacaagtgacggcaactggattatgccat
ggagatatacatatagctatgggagaatgggattctcagattcaggtaaatcttcccata
atacttggtcatgaagttgttggaagagtacttcaaagcaaccatgataaaattaagaaa
aatgatctagttttagtatataacgcctttggttgtaaaaattgtaaatactgtaaattt
aaagagtatcaattttgtgaaaaagtgaaagttataggagtaaaccttaacggaggattt
gctgaatatgtcaaaattcctgatggcgacaatctggttagggttaatacctcagatcca
ataaagttagcacctcttgccgatgctgggttgactgcttataatagtgttaaggattta
gaagagaattctaaagtcctgataataggaactggtgccgtagcactgatagctttacag
cttttgaagctaaaaaatgtggatgttacagtaattggtgagaatcaactaaaacttgat
agtgcagaaaaattaggtgcagatgaagttatatcaattaagcgagaagaagatagttat
ctttctctgctcccagggaagaaattcgattatattttagattatgtaggctcaacgaga
accttagccgaatcaccctggctcttgaataaaaaaggcgaattaagaataattggggaa
tttggtggagtccttagagcggaagaacaattactagttcttagaggtttaagaatacga
gggatactttatggtagccttcaagatctaaaacatattttagatatttatttaaagggt
aagattgatacacttaccacggtgtataagctagaggatataaatgaggctattactgat
gtaactgaaggtaaggtagtaggaagggcagttattgtaccctaa

DBGET integrated database retrieval system