KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0239Help
Entry
Saci_0239         CDS       T00251                                 

Definition
(GenBank) haloacid dehalogenase-like hydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
K07025  putative hydrolase of the HAD superfamily
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
sai00361  Chlorocyclohexane and chlorobenzene degradation
sai00625  Chloroalkane and chloroalkene degradation
sai01100  Metabolic pathways
sai01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sai00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Saci_0239
   00361 Chlorocyclohexane and chlorobenzene degradation
    Saci_0239
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Saci_0239
Enzymes [BR:sai01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     Saci_0239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase LisH Hydrolase_6 Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AAY79656
UniProt: Q4JC23
Position
198658..199305
Genome map
AA seq 215 aa AA seqDB search
MDKIACVDLGDTLVAFEPRRYQLIYDFLRDNGYNLSLSKVYRAYVRSLSKFNFPDDNGVN
PFDVKDFLYELGLDPSNEKLTKKISSISRGSEYHIYDDAIDFLEYLRSEGYKTALVSNAT
PRARNVVYSLGLHKYLDILIFSFEVGVVKPNPKIFTYVREKLGEPDFHLGDIAEMDIQGA
KRATLKRGILLDRFGFYGTDIKTLKDVIRSLEALR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaatagcatgcgtagatttaggagatacgttggtagcatttgagccgagaaga
taccaactgatatatgattttttgagagacaacggatacaatctaagtctatcaaaagta
tatagagcttacgtaaggagtctctcgaagttcaattttcctgacgataatggtgtaaac
ccatttgatgtaaaagacttcctctatgagttgggcttagacccatctaatgagaagtta
acaaagaaaatttcatctatatcaagaggtagtgaataccacatctatgatgatgccata
gatttcctagagtaccttagatctgaaggttataaaacagctctagtttcaaatgccact
cctagggcaagaaatgtagtatactcgttaggtctccataaatatcttgacatcctaata
ttttcctttgaagtaggggtcgttaaaccaaatccaaaaattttcacatatgttagggag
aaattaggcgagccagactttcacttaggtgatattgctgaaatggatatacagggagct
aagagggcaacgctaaaaaggggaattcttttggataggtttggattctatggtacggat
attaagacattgaaagacgttattcgctctttagaggctttgcggtaa

DBGET integrated database retrieval system