KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0578Help
Entry
Saci_0578         CDS       T00251                                 

Definition
(GenBank) 50S ribosomal protein L18P
  KO
K02881  large subunit ribosomal protein L18
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
sai03010  Ribosome
Module
sai_M00179  Ribosome, archaea
Brite
KEGG Orthology (KO) [BR:sai00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Saci_0578
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sai03011]
    Saci_0578
Ribosome [BR:sai03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Saci_0578
  Bacteria
    Saci_0578
  Archaea
    Saci_0578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L5e Ribosomal_L18_c
Motif
Other DBs
NCBI-ProteinID: AAY79970
UniProt: O05640
Position
complement(466206..466799)
Genome map
AA seq 197 aa AA seqDB search
MTQGPNYRIKFRRRREGKTDYYTRYTYVINNAIRFVPRLTNKYVIVSVSKFDQKGDIMIA
YAHSIELVKKYGWKGDTNNTPAAYLTGYLAGLRAVKSGVKAAVSDIGLFVPVKGGRIFAV
IKGAIDAGLKVPVGDLGKLKDRVNGSHISAYAQKLKNENQELYNKLFSSYIQRGLDPVLL
PQHFEEVLNKIKENGGK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgacacagggacctaattataggataaagtttagaaggagaagagaaggaaaaacagac
tattatacgagatatacttatgttattaataatgcaataaggtttgttcccaggttaact
aataagtacgtaatagtaagtgtgagtaagtttgatcaaaaaggagatataatgatagct
tatgctcactctatagaactagtaaagaaatatggttggaaaggggatactaataataca
cctgcagcatatcttactggttatctagcaggattaagagccgttaaatctggtgtgaaa
gctgctgtttcagatattggcttatttgtacctgtaaaaggagggaggatatttgcagtg
attaaaggtgcaatagacgcgggcttaaaggttcccgttggcgatttaggtaaattgaaa
gacagagttaatggcagccatatatctgcctatgctcaaaaattgaaaaatgagaaccaa
gaattatacaataagcttttcagttcatacattcagaggggtcttgaccctgtcttgctt
cctcaacactttgaggaagtgttaaataagattaaggaaaatggtggtaagtga

DBGET integrated database retrieval system