KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0671Help
Entry
Saci_0671         CDS       T00251                                 

Definition
(GenBank) conserved Archaeal protein
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
sai00010  Glycolysis / Gluconeogenesis
sai00030  Pentose phosphate pathway
sai00051  Fructose and mannose metabolism
sai00680  Methane metabolism
sai01100  Metabolic pathways
sai01110  Biosynthesis of secondary metabolites
sai01120  Microbial metabolism in diverse environments
sai01130  Biosynthesis of antibiotics
sai01200  Carbon metabolism
sai01230  Biosynthesis of amino acids
Module
sai_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saci_0671
   00030 Pentose phosphate pathway
    Saci_0671
   00051 Fructose and mannose metabolism
    Saci_0671
  Energy metabolism
   00680 Methane metabolism
    Saci_0671
Enzymes [BR:sai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Saci_0671
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Saci_0671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: AAY80055
UniProt: Q4JAX4
Position
complement(531780..532937)
Genome map
AA seq 385 aa AA seqDB search
MKTTISVIKADIGSLAGHHVVHPDTMAAASKVLAEAKSQSLLIDYYITHVGDDLELIMTH
TRGELDTKVHETAWNAFKEAAKVAKELGLYAAGQDLLSDSFSGNVRGLGPGVAEIEVEER
PSEPIAIFMADKTEPGAFNLPLYKMFADPFNTPGLVIDPTMHNGFKFEVLDVYQGEAVVL
NAPQELYDLLALIGTPSRYVIRRIYRSEDNLLGAVVSIERLNLIAGKYVGKDDPVTIVRL
QHGLPALGEALEAFTLPHLVPGWMRGSHYGPLIPVSQRDARATRFDGPPRLIGLGFNVKN
GKLVGPSDLFDDPAFDEVRRLANTITDYMRRHGPFMPHRLEPTEMEYTTLPIILEKLRSR
FKKESDVYKVKESIYSKEKSGPSGD
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaacaattagtgtaataaaagcagatataggtagtttagccggacatcatgtt
gtacatccagatactatggcagcagcaagtaaagttctagctgaagctaagagtcaaagt
ctacttatagattattatataactcacgtgggtgatgacctagagctcataatgactcat
actagaggagaactggatactaaggttcatgaaactgcttggaacgcttttaaagaagca
gcaaaggttgcaaaggagttaggtttatacgcagctggtcaggatcttttatcagactcc
ttctcaggaaatgttagagggctaggaccaggcgtagctgagatagaagtagaggaaaga
ccgtcagagcctatagctatatttatggcagataagacagaacctggagcctttaactta
cctctatataaaatgtttgcagacccatttaacacgccaggtcttgtaatagatccgact
atgcataacggattcaaatttgaagttctagatgtatatcagggagaagcagttgtgtta
aacgctcctcaagagctttatgatctactagccttaatcggaactccgtcaagatatgta
attagaagaatatatagaagtgaggataaccttttaggagctgtagtatctatagaaaga
ttaaatttgattgcaggaaagtatgtaggaaaagacgatccggtaaccatagttagattg
caacatggtttgcctgcattaggtgaagctctagaggcatttacactacctcaccttgtt
cctggttggatgagaggtagtcactatggtcctcttattccagtatctcagagagatgct
agggctaccagatttgatggtcctccaaggcttatagggttaggttttaacgttaaaaat
ggaaagttggtaggtccatcagatttatttgatgatcctgcttttgatgaagttagaaga
ttagcaaataccataacagattacatgagaaggcatggtccatttatgcctcatagattg
gagcctactgaaatggaatatacaactctgccaattatacttgaaaaattgaggtctagg
tttaaaaaagagagcgatgtgtataaggtaaaagaaagtatatattcaaaagaaaaaagc
ggaccatcaggagattaa

DBGET integrated database retrieval system