KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0686Help
Entry
Saci_0686         CDS       T00251                                 

Definition
(GenBank) 30S ribosomal protein S7P
  KO
K02992  small subunit ribosomal protein S7
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
sai03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sai00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Saci_0686
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sai03011]
    Saci_0686
Ribosome [BR:sai03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    Saci_0686
  Bacteria
    Saci_0686
  Archaea
    Saci_0686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S7
Motif
Other DBs
NCBI-ProteinID: AAY80066
UniProt: P17198
Position
complement(544383..544970)
Genome map
AA seq 195 aa AA seqDB search
MVENIEVSNLNVKVFGKWDTKVEVRDPSLKKYIDLMSIYLPHTGGRHEHRRFGKSRIPIV
ERLINNLMRPGRNKGKKMLAYNIVKTTFDIIAVKTGQNPIQVLVRAIENAAPREEVTRIM
YGGIVYYVAVDVAPQRRVDLALRHLVTGASEASFNNPKPIEEALAEEIIAAANNDNKSVA
IRKKEEIERIALSSR
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggttgagaatattgaagtttcaaatttgaacgttaaggtatttggaaagtgggacact
aaggttgaggttagagatccaagtttaaagaaatatatagatttaatgtctatataccta
cctcatactggaggcagacatgagcatagaagatttggaaaatcaagaatacctatagta
gaaagattgataaataacttaatgagaccaggtaggaataaaggtaaaaaaatgcttgca
tataatatagtaaaaacaacatttgatattatagcagtaaagaccggtcagaatccaatc
caagttttagtgagagcaattgagaatgctgctcccagagaggaggtaacccgtataatg
tacggtggaatagtttactatgtagccgtagatgtagcaccccagagaagagtcgattta
gcactaagacatttagttactggagctagtgaagcttcatttaacaatcccaaacccata
gaagaagcgttagctgaagaaataattgccgcagcaaataatgataataagagtgtagca
ataaggaagaaagaagagatagagagaatagcgttaagctctaggtaa

DBGET integrated database retrieval system