KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1413Help
Entry
Saci_1413         CDS       T00251                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
sai00260  Glycine, serine and threonine metabolism
sai00750  Vitamin B6 metabolism
sai01100  Metabolic pathways
sai01110  Biosynthesis of secondary metabolites
sai01120  Microbial metabolism in diverse environments
sai01230  Biosynthesis of amino acids
Module
sai_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Saci_1413
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Saci_1413
Enzymes [BR:sai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Saci_1413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Zn-ribbon_8 Prok-RING_1 zf-RING_7 HypA DNA_RNApol_7kD
Motif
Other DBs
NCBI-ProteinID: AAY80743
UniProt: Q4J8Y7
Position
complement(1205197..1206375)
Genome map
AA seq 392 aa AA seqDB search
MKCLDCGYELSELRQDIITCPSCGGLLEIKIEFPSEFDLRRLKGRGVWRYKDVIAGEYNK
IVTLDEGNTPLIKSRKYDKTYFKFEGANPTGSFKDRGMTVAISSALSLNYKIVVAASTGN
TAASAAAYSSRAGLKSFIVLPKGKVALGKLAQSILYGTVIIEVDGSFDIAMNSVMKLYRD
HKIVYPLNSFNPWRLEGQKTIAYEIVEDIGVPDNVIVPVGNAGNIYAIWKGFNELLEGGL
IDKVPRMIGIQAEGAAPIAKALEKGLEQPEFVDSPDTIASAIRIGKPVNWKKAIKAMKSS
KGFAVYVSDNEIITAQQELARREGVGAEPASAAAYAGYLKLLSSKKIEESEKSVVILTGH
ALKDPDIMIKAEAKRILVNPEHIDQVILGDQI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgtttagactgtggatatgagttaagtgaattaagacaagacataataacctgc
ccctcatgtggaggattattagagataaaaattgaattccctagtgagtttgaccttaga
agattaaagggaagaggagtatggaggtataaagatgttatagcaggggaatataataaa
attgtaaccttagatgagggcaatacacccttaataaaatctagaaaatacgataagaca
tatttcaagtttgaaggagcaaatcccacaggaagttttaaagatagaggaatgacagta
gcgattagctctgcattatctctaaattataaaatagttgttgcggcttctacaggaaat
actgcagcatcagcagctgcctattcaagtagagcgggtttaaagagtttcatagtttta
cctaaaggaaaagtagcattaggaaagttagcacagtctatattgtatggtactgtaata
atagaagttgatggaagcttcgatatagcaatgaatagtgttatgaaactttatagagat
cataaaatagtttacccactaaactcgtttaatccctggagattagaaggtcaaaaaact
atagcttatgagatagtggaagacataggagtccctgataatgtaatagtaccagtaggg
aatgctggaaatatctatgcgatatggaaaggatttaatgaactcctagaaggaggctta
atagataaagttcctagaatgataggaatacaagcagaaggtgcagctccaatagctaag
gcactagaaaaaggacttgagcaaccagaattcgtagactcccctgatacgatagcttca
gcaataagaataggtaaaccggttaattggaaaaaagccataaaagcaatgaagtcaagt
aaaggattcgcagtgtatgtatctgataacgagattataactgctcaacaagaattggct
agaagagagggagtaggggctgaacctgcatctgctgcagcatatgctggatatctgaag
ctcttgtcatcaaagaagatagaagaaagtgagaaaagcgttgtaattctaacaggacat
gccctaaaagatccggatataatgataaaagcagaggctaaacgtattctggtgaatcct
gaacatatagatcaagttattttaggtgatcaaatatga

DBGET integrated database retrieval system