KEGG   Sulfolobus acidocaldarius DSM 639: Saci_2235Help
Entry
Saci_2235         CDS       T00251                                 

Definition
(GenBank) acyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
sai00010  Glycolysis / Gluconeogenesis
sai00620  Pyruvate metabolism
sai00640  Propanoate metabolism
sai00680  Methane metabolism
sai00720  Carbon fixation pathways in prokaryotes
sai01100  Metabolic pathways
sai01110  Biosynthesis of secondary metabolites
sai01120  Microbial metabolism in diverse environments
sai01130  Biosynthesis of antibiotics
sai01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saci_2235
   00620 Pyruvate metabolism
    Saci_2235
   00640 Propanoate metabolism
    Saci_2235
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Saci_2235
   00680 Methane metabolism
    Saci_2235
Enzymes [BR:sai01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Saci_2235
Lipid biosynthesis proteins [BR:sai01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Saci_2235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AAY81521
UniProt: Q4J6R1
Position
2077650..2079509
Genome map
AA seq 619 aa AA seqDB search
MNWRIYSLEQIKSMSKYAMDDPTSFWRDKTEYITWFKKPESIVEGQAPYDKWFVRGTTNI
SYNAVDRHIPSRKDKVAFYWANERFETKTVSYLDLYNEVNKATYVLQELGVRKGDSVSLL
FPSIPEAVFFSLAVHRLGAVLVIHYVGLSHETLAYRLNDCGSKVMVVASKGIRNGNEIRI
KDFVDKLLDSHTTPVKSVLVVSRGYSDFEVKQNRDIVYEDVKPKGKVYVRPEEVESNEPG
TIYYTSGTTGKPKGLFHSHAGYTIGLNWAFRALLNPQDNEVWWTVSELGWPVWPMANLYT
IPVMGITGVLFEGFIGYKRDLFSRVIERFNVNYVWSSTTTLYTLKSLGEESVKSGDTSSL
KIILNTGEPLNVGAWNWLTENMPHVKIGDAYWMTEHLIPIACTPYGLGEIPYKPGSAGIV
FPGTYFTVVDDDGKPLPPKQKGYIVVKPLNPATAKMWNDPTYEKIKDKYWSRFPGYFYTG
DYGYVDEDGYLFVLGRADDVIRSEGERIGTLEVESIIGTYPQVAETAVVGTTNSIVAFVV
PKQGVNPDDVLRNEIKNYCRNSGYIVDKVIFLKRLPKTKSGKIMRRLLKSILANEDPGDV
STLDDIKIIEELKQSLSQT
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgaattggagaatatattctttagaacaaattaaatccatgagcaagtatgccatggat
gatcccacgagcttttggagggataaaactgagtatatcacttggttcaaaaagcctgaa
agtattgtagaggggcaagcaccatatgacaagtggtttgtgagaggaaccacaaatatc
agttataacgccgtagataggcatattcccagtaggaaagataaagtggcattttactgg
gctaatgagagatttgagactaagactgtgtcatatctagatttgtacaatgaggtgaat
aaggcaacatatgtactgcaagagctgggagtgagaaaaggagatagtgtatcacttcta
tttcctagtattccggaggcagtattttttagtcttgccgtacacagattgggtgcagta
cttgtaattcattatgtaggattaagccatgagacattagcttataggttaaatgactgc
ggatcaaaggtgatggttgttgcctcgaaggggattagaaacggtaacgagataagaatc
aaggactttgtggacaaattacttgactcccataccacaccagtaaagagtgtgcttgta
gtgtcaagaggttactcggattttgaagttaaacaaaacagggatattgtatatgaggat
gtaaaaccaaagggaaaggtgtacgttagaccagaggaagtggaatcaaacgagcccggt
actatttactatacttctggtaccactggtaagcctaaagggttattccactctcacgcc
ggttataccataggcttaaactgggcttttagggcacttttaaatcctcaggataatgag
gtgtggtggacagtatctgaattagggtggcctgtttggcccatggctaacctatacaca
attccagtaatgggaattacaggagtcctatttgagggattcataggatataaaagggat
ttgttctctagggtcatagaacgatttaacgtaaattacgtatggagctcgaccactaca
ctttacactcttaagagtttaggtgaagaatctgtaaagtcaggagacacttcgagctta
aagatcattcttaacacaggggaaccgctaaatgtaggggcatggaactggttaactgaa
aacatgcctcatgtgaagatcggtgacgcttattggatgacagaacaccttatacccata
gcctgcacaccatatggattaggagagattccttacaaacctgggtctgctggtatagta
ttcccaggtacatatttcacggtagtagacgatgatggaaagcctttgccaccaaagcag
aagggatacatagtggtcaaacctttaaatcctgccacagctaagatgtggaatgacccc
acttacgagaaaataaaagataaatattggtctagattcccaggttacttctatacaggg
gattacggatatgtagatgaagacggatatctttttgtactgggaagagctgacgacgtg
ataagaagtgagggagaaagaataggaacccttgaggtggaaagtataattgggacctat
cctcaagttgcagagactgcagttgtgggaacaacaaattctattgtggcttttgttgtt
cctaagcagggagttaacccagatgatgttttaagaaatgaaatcaagaactattgtaga
aactctggatatattgtagataaggtgatatttcttaagaggttaccaaagactaagagc
ggaaagattatgagaagattattaaagtcaattttagctaacgaggatccgggtgatgtt
tcaactctagatgacatcaagattattgaagagttaaaacagtcccttagccagacataa

DBGET integrated database retrieval system