KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA): SaurJH9_0210
Entry
SaurJH9_0210      CDS       T00522                                 

Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA)
Pathway
saj00620  Pyruvate metabolism
saj00640  Propanoate metabolism
saj00650  Butanoate metabolism
saj01100  Metabolic pathways
saj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:saj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SaurJH9_0210
   00640 Propanoate metabolism
    SaurJH9_0210
   00650 Butanoate metabolism
    SaurJH9_0210
Enzymes [BR:saj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     SaurJH9_0210
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029 zf-C2HCIx2C
Other DBs
NCBI-ProteinID: ABQ48017
Position
252648..254897
AA seq 749 aa
MLETNKNHATAWQGFKNGRWNRHVDVREFIQLNYTLYEGNDSFLAGPTEATSKLWEQVMQ
LSKEERERGGMWDMDTKVASTITSHDAGYLDKDLETIVGVQTEKPFKRSMQPFGGIRMAK
AACEAYGYELDEETEKIFTDYRKTHNQGVFDAYSREMLNCRKAGVITGLPDAYGRGRIIG
DYRRVALYGVDFLMEEKMHDFNTMSTEMSEDVIRLREELSEQYRALKELKELGQKYGFDL
SRPAENFKEAVQWLYLAYLAAIKEQNGAAMSLGRTSTFLDIYAERDLKAGVITESEVQEI
IDHFIMKLRIVKFARTPDYNELFSGDPTWVTESIGGVGIDGRPLVTKNSFRFLHSLDNLG
PAPEPNLTVLWSVRLPDNFKTYCAKMSIKTSSIQYENDDIMRESYGDDYGIACCVSAMTI
GKQMQFFGARANLAKTLLYAINGGKDEKSGAQVGPNFEGINSEVLEYDEVFKKFDQMMDW
LAGVYINSLNVIHYMHDKYSYERIEMALHDTEIVRTMATGIAGLSVAADSLSAIKYAQVK
PIRNEEGLVVDFEIEGDFPKYGNNDDRVDDIAVDLVERFMTKLRSHKTYRDSEHTMSVLT
ITSNVVYGKKTGNTPDGRKAGEPFAPGANPMHGRDQKGALSSLSSVAKIPYDCCKDGISN
TFSIVPKSLGKEPEDQNRNLTSMLDGYAMQCGHHLNINVFNRETLIDAMEHPEEYPQLTI
RVSGYAVNFIKLTREQQLDVISRTFHESM
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgttagaaacaaataaaaatcatgcaacagcttggcaaggatttaaaaatggaagatgg
aacagacacgtagatgtaagagagtttatccaattaaactacactctttatgaaggtaat
gattcatttttagcaggaccaacagaagcaacttctaaactttgggaacaagtaatgcag
ttatcgaaagaagaacgtgaacgtggcggcatgtgggatatggacacgaaagtagcttca
acaatcacatctcatgatgctggttatttagacaaagatttagaaacaattgtaggtgta
caaactgaaaagccattcaaacgttcaatgcaaccattcggtggtattcgtatggcgaaa
gcagcttgtgaagcttacggttacgaattagacgaagaaactgaaaaaatctttacagat
tatcgtaaaacacataaccaaggtgtattcgatgcatattctagagaaatgttgaactgc
cgtaaagcaggtgtaatcactggtttacctgatgcatacggacgtggacgtattatcggt
gactatcgtcgtgtagctttatatggtgtagatttcttaatggaagaaaaaatgcacgac
ttcaacacgatgtctacagaaatgtcagaagatgtaattcgtttacgtgaagaattatca
gaacaatatcgtgcattaaaagaattaaaagaacttggacaaaaatatggtttcgattta
agccgtccagcagaaaacttcaaagaagcagttcaatggttatacttagcataccttgct
gcaattaaagaacaaaacggtgcagcaatgagtttaggtcgtacatcaacattcttagat
atctatgctgaacgtgaccttaaagcaggcgttattactgaaagcgaagttcaagaaatt
attgaccacttcatcatgaaattacgtattgttaaatttgctcgtacacctgattacaat
gaattattctctggagacccaacttgggtaactgaatctatcggtggtgtaggtattgac
ggacgtccacttgttacgaaaaactcattccgtttcttacactcattagataacttaggt
ccagctccagaaccaaacttaacagtattatggtcagtacgtttacctgacaacttcaaa
acatactgtgcaaaaatgagtattaaaacaagttctatccaatatgaaaatgatgacatt
atgcgcgaaagctatggcgatgactatggtatcgcatgttgtgtatcagcgatgacaatt
ggtaaacaaatgcaattcttcggtgcacgtgcgaacttagctaaaacattactttacgca
atcaatggtggtaaagatgaaaaatctggtgcacaagttggtccaaacttcgaaggtatt
aacagcgaagtattagaatatgacgaagtattcaagaaatttgatcaaatgatggattgg
ctagcaggtgtttacattaactcattaaatgttattcactacatgcacgataaatacagc
tatgaacgtattgaaatggcattacatgatacagaaattgtacgtacaatggcaacaggt
atcgctggtttatcagtagcagctgactcattatctgcaattaaatatgcacaagttaaa
ccaattcgtaacgaagaaggtcttgtagtagactttgaaatcgaaggcgacttccctaaa
tacggtaacaatgacgaccgtgtagatgatatcgcagttgatttagtagaacgcttcatg
actaaattacgtagtcataaaacatatcgtgattcagaacatacaatgagtgtattaaca
attacttcaaacgttgtatacggtaagaaaactggtaacacaccagacggacgtaaagct
ggcgaaccatttgctccaggtgcaaacccaatgcatggccgtgaccaaaaaggtgcatta
tcttcattaagttctgtagctaagatcccttacgattgctgtaaagatggtatttcaaat
acattcagtatcgtaccaaaatcattaggtaaagaaccagaagatcaaaaccgtaactta
actagtatgttagatggttacgcaatgcaatgtggtcaccacttaaatattaacgtattt
aaccgtgaaacattaatagatgcaatggaacatccagaagaatatccacagttaacaatc
cgtgtatctggttacgctgttaacttcattaaattaacacgtgaacaacaattagatgta
atttctcgtacattccatgaaagtatgtaa

DBGET integrated database retrieval system