KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA): SaurJH9_0563
Entry
SaurJH9_0563      CDS       T00522                                 

Definition
(GenBank) LSU ribosomal protein L12P
  KO
K02935  large subunit ribosomal protein L7/L12
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA)
Pathway
saj03010  Ribosome
Brite
KEGG Orthology (KO) [BR:saj00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SaurJH9_0563
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:saj03011]
    SaurJH9_0563
Ribosome [BR:saj03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SaurJH9_0563
  Bacteria
    SaurJH9_0563
SSDB
Motif
Pfam: Ribosomal_L12 Ribosomal_L12_N Bac_DNA_binding DUF2267 CwsA PP2C_C
Other DBs
NCBI-ProteinID: ABQ48367
UniProt: A5IQ94
Position
618777..619145
AA seq 122 aa
MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVEL
TSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVE
LK
NT seq 369 nt   +upstreamnt  +downstreamnt
atggctaatcatgaacaaatcattgaagcgattaaagaaatgtcagtattagaattaaac
gacttagtaaaagcaattgaagaagaatttggtgtaactgcagctgctccagtagcagta
gcaggtgcagctggtggcgctgacgctgcagcagaaaaaactgaatttgacgttgagtta
acttcagctggttcatctaaaatcaaagttgttaaagctgttaaagaagcaactggttta
ggattaaaagatgctaaagaattagtagacggagctcctaaagtaatcaaagaagcttta
cctaaagaagaagctgaaaaacttaaagaacaattagaagaagttggagctactgtagaa
ttaaaataa

DBGET integrated database retrieval system