KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA): SaurJH9_0658
Entry
SaurJH9_0658      CDS       T00522                                 

Definition
(GenBank) hypothetical protein
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA)
Motif
Pfam: Peptidase_M50B Otopetrin Peptidase_M50
Other DBs
NCBI-ProteinID: ABQ48461
Position
complement(724609..725361)
AA seq 250 aa
MNYLSNFFNTTIQLNIYIIVIVAACYIAIHQYRHKPVLNYLDVILNYIPVLTHEFGHVLF
NKLAGGRAKDLVIVTSPRERQQTLQQGFAITQSRHLAGQWLTTIGGYLMPPIMLLIGLAS
SHYQIPSFFIFTYLLIFIYFLILTSRKGSPIVVITLISIMLYFILKDENIVEIQLLVTMS
YQYILGVLLGEVLQSSWTIAKLTFQRPSPQWDGSALKELSHVPIFIYSTIWIIFNLYAVN
ILLKYTHLIN
NT seq 753 nt   +upstreamnt  +downstreamnt
atgaattatttatcaaacttttttaatacgacaattcaacttaatatatacattatcgtt
attgttgcagcttgttatattgctattcatcaatatagacataagcctgttttgaactat
ttagatgtcattttaaactatatccctgttttaacacatgaatttggtcatgtactgttt
aataaactcgctggtggccgtgcaaaagatttagtcattgtaacaagtccacgagagcga
caacagacattacaacaaggattcgcaattacacaatctagacatctagcaggccaatgg
cttacaacgattggtggttatttaatgccacctattatgttattgataggtttagcgtcg
agccattatcagatacctagtttctttatatttacctatttattgatatttatttatttt
ttaattttaacatctagaaaaggctcacccattgttgttataactttaatttctatcatg
ttgtattttatattaaaagatgaaaatatagtagaaattcaactacttgtcacaatgagt
tatcaatatattttaggtgtattattaggcgaagttctacaatctagttggacgattgct
aaattgactttccagcgtccgagtccacagtgggatggtagtgcacttaaagaactcagt
catgtacctatcttcatttatagtacaatctggattatcttcaatctttatgcagtgaat
attttactcaaatatactcacttgataaattaa

DBGET integrated database retrieval system