KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA): SaurJH9_0786
Entry
SaurJH9_0786      CDS       T00522                                 
Name
(GenBank) transferase hexapeptide repeat containing protein
  KO
K24872  heptaprenylglycerol acetyltransferase [EC:2.3.1.-]
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA)
Pathway
saj00564  Glycerophospholipid metabolism
saj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SaurJH9_0786
Enzymes [BR:saj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-
     SaurJH9_0786
SSDB
Motif
Pfam: Hexapep_2 Hexapep
Other DBs
NCBI-ProteinID: ABQ48589
Position
862280..862765
AA seq 161 aa
MRKFLSKTHHHTNPLWRVYRLVKFSKVFKNVIIIEFSKFIPSMVLKRHIYKQLLNINIGN
QSSIAYKVMLDIFYPELITIGSNSVIGYNVTILTHEALVDEFRYGPVTIGSNTLIGANAT
ILPGITIGDNVKVAAGTVVSKDIPDNGFAYGNPMYIKMIRR
NT seq 486 nt   +upstreamnt  +downstreamnt
ttgagaaaatttttatcaaaaacacatcatcatacaaaccctttatggcgtgtataccgt
cttgttaaattttcgaaagtttttaagaatgtaattatcattgaattttcgaaatttatt
ccaagtatggtactgaaaagacatatatataaacaacttttaaatattaatatcggtaat
caatcatcgatagcttataaagtaatgttagatattttttacccagaactgattacgatt
ggtagtaacagtgttattggttacaatgtaacaattttgacgcatgaagcattagttgat
gaatttcgttatggaccagtgacgataggatctaacactttgattggtgcaaatgctacc
attttacccggtataacgattggtgacaatgtaaaagttgcagctggtacggttgtttca
aaagatataccggataatggatttgcatatggcaaccctatgtatataaaaatgattagg
aggtga

DBGET integrated database retrieval system