KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA): SaurJH9_0929
Entry
SaurJH9_0929      CDS       T00522                                 

Name
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
  KO
K00015  glyoxylate reductase [EC:1.1.1.26]
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA)
Pathway
saj00630  Glyoxylate and dicarboxylate metabolism
saj01100  Metabolic pathways
saj01110  Biosynthesis of secondary metabolites
saj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:saj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SaurJH9_0929
Enzymes [BR:saj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.26  glyoxylate reductase
     SaurJH9_0929
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored AdoHcyase_NAD IlvN
Other DBs
NCBI-ProteinID: ABQ48730
Position
975857..976816
AA seq 319 aa
MVKIVVSRKIPDKFYQQLSKLGDVVMWQKSLVPMPKDQFVTALRDADACFITLSEQIDAE
ILAQSPNLKVIANMAVGYDNIDVESATANNVVVTNTPNVLTETTAELGFTLMLAIARRIV
EAEKYVEADAWQSWGPYLLSGKDVFNSTIGIYGMGDIGKAFARRLQGFNTNILYHNRSRH
KDAEADFNATYVSFETLLAESDFIICTAPLTKETHHKFNAEAFEQMKNDAIFINIGRGQI
VDETALIDALDNKEILACGLDVLANEPIDHTHPLMGRDNVLITPHIGSASVTTRDNMIQL
CINNIEAVMTNQVPHTPVN
NT seq 960 nt   +upstreamnt  +downstreamnt
ttggtaaaaatagttgtttcgaggaaaattccagataaattttatcaacaattaagtaaa
cttggtgacgttgttatgtggcaaaaatcattagtgcctatgcctaaagatcaatttgtg
acagcacttcgtgacgcagatgcttgttttattacattaagtgaacagatcgatgcagaa
attttagcacaatcaccaaatttaaaagtaattgcgaatatggctgtaggatatgacaac
atcgatgttgaaagtgcaacagcgaataacgtggttgtcacgaatacaccaaatgtactt
actgaaacaactgcagaattaggatttacattaatgcttgctatagcacgccgtattgta
gaagctgaaaaatatgtagaagcagatgcatggcaaagctggggtccttatttattgtca
ggtaaagatgtcttcaattcaactattggaatatatggtatgggagatattggtaaagct
tttgcaagaaggttgcaagggtttaatactaatattctttatcataatcgatcaagacat
aaagatgcagaggcggactttaatgcaacatatgtttcttttgaaacgttgttagcagaa
agtgattttatcatctgtacagcgccacttacaaaagaaacacatcataaatttaatgct
gaagcatttgaacaaatgaaaaatgatgcaatttttattaatatcggtagagggcaaatt
gtagatgaaacagcattaatcgatgcactagacaataaagaaattttagcatgtggttta
gatgtattagcaaatgaaccgattgatcatacacatccattaatgggacgtgataatgtt
ctgattacaccacacattggtagcgcatcagtaacaacacgggacaatatgattcaatta
tgtattaataatatagaagcggttatgacaaatcaggtaccacatactccagtaaattga

DBGET integrated database retrieval system