KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA): SaurJH9_1111
Entry
SaurJH9_1111      CDS       T00522                                 

Name
(GenBank) hypothetical protein
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA)
SSDB
Other DBs
NCBI-ProteinID: ABQ48911
Position
1150804..1150914
AA seq 36 aa
MSLCTQQKLNHELQAKVAVIVKIDGKQSPLFLLVYV
NT seq 111 nt   +upstreamnt  +downstreamnt
gtgtcattgtgcacacaacaaaaattgaatcatgaattacaagcaaaagtagcggtgatt
gttaaaattgatggtaaacaatcaccgctatttttgcttgtgtatgtataa

DBGET integrated database retrieval system