KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA): SaurJH9_2339
Entry
SaurJH9_2339      CDS       T00522                                 

Name
(GenBank) transcriptional regulator, RpiR family
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA)
SSDB
Motif
Pfam: HTH_6 SIS SIS_2 DUF2529 HTH_Crp_2 FleQ Med25
Other DBs
NCBI-ProteinID: ABQ50119
Position
2470281..2471153
AA seq 290 aa
MSNVLTEIDSQYPYMTKNEKKIAKFILNSPQKVIKMRSQDLASLLDISTSSVIRFSKKIT
DGGFHDLKINISKYVPKASSIYNVELMNNESTESLRTKLHTRTTRALNHANNELNDKTID
QICHCLKRSETIFIYGFGASFVVATDLYQKLSRIGLNIQLVQETHIFATLLATHNSNDSV
ILITNNGTQSEMQSMVKVIDDYHIPIITITSTRDNPVAQASNIVLTYGKTDENEMHMGAT
TSLFAQMFTIDILYYRYVALNYHASLDFITQSKMALDNYRKHLSNINFKH
NT seq 873 nt   +upstreamnt  +downstreamnt
atgtcaaacgtactaacagaaatagatagtcaatatccatatatgactaaaaatgaaaaa
aagatagctaaatttatactaaattcacctcaaaaggtgattaaaatgaggtctcaagac
ttagcaagcttattagatattagtacatcatcagtcattcgattcagcaagaaaattact
gatggcggttttcacgacttgaaaataaatatatctaaatatgttcctaaagcatcatca
atttacaatgttgaattaatgaataacgaaagcacagaatctttaagaactaaactccat
acacgtactacacgcgcacttaatcatgcaaataacgaattaaatgataaaactattgat
caaatatgtcattgtttaaaacgttctgagacgatttttatatatggttttggcgcatct
tttgtagttgctaccgacttataccaaaagttatcaagaataggtcttaatattcaactt
gttcaagaaacacatatttttgctacattattagcaactcacaattcgaacgacagtgtt
attcttattactaacaatggtacgcaaagtgaaatgcaatcaatggttaaagttattgat
gactaccatatacctataattacaattactagtacaagggataatcccgtagcacaggca
tcaaatattgttttaacttatgggaaaactgatgaaaatgagatgcatatgggagcaaca
acttcattatttgctcaaatgttcactattgatattttatattatcgttatgttgcatta
aattatcacgcatcattagatttcataacacaatctaaaatggctttagataactatcgt
aaacatttatcaaatattaactttaaacattaa

DBGET integrated database retrieval system