KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA): SaurJH9_2412
Entry
SaurJH9_2412      CDS       T00522                                 

Name
(GenBank) major facilitator superfamily MFS_1
  KO
K10850  MFS transporter, NNP family, putative nitrate transporter
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA)
Pathway
saj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:saj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SaurJH9_2412
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:saj02000]
    SaurJH9_2412
Transporters [BR:saj02000]
 Major facilitator superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    SaurJH9_2412
SSDB
Motif
Pfam: MFS_1 OATP 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: ABQ50192
UniProt: A5IVG9
Position
complement(2545543..2546712)
AA seq 389 aa
MYKTKGGFQLTLQTLSLVVGFMAWSIIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLR
VPFGYLTNIVGAKWVFFTSFIVLLFPIFFLSQAQTPGMLMASGFFLGVGGAIFSVGVTSV
PKYFPKEKVGLANGIYGMGNIGTAVSSFLAPPIAGIIGWQTTVRSYLIIIALFALIMFIF
GDTQERKIKVPLMAQMKTLSKNYKLYYLSYWYFITFGAFVAFGIFLPNYLVNHFGIDKVD
AGIRSGVFIALATFLRPIGGILGDKFNAVKVLMIDFVIMIIGAVILGISDHIALFTVGCL
TISICAGIGNGLIFKLVPSYFSNEAGSANGIVSMMGGLGGFFPPLVITYVANLTGSSHLA
FIFLAVFGCIALFTMRHLYQKEYGSLKHS
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgtacaaaacaaaaggtggctttcaacttacattacaaacattaagtttagtggttggg
tttatggcttggagtataattgcgccattaatgccctttattaaacaagatgtcaatgtt
actgaaggtcaaatatcaatcattttagcgataccagttattttgggatcagtgctccgt
gtgccatttggttatttaacaaatattgttggtgctaaatgggtattctttacaagtttt
atcgtattgttattcccgatatttttcttaagccaagcacaaacgccgggtatgttaatg
gcatcaggatttttccttggcgtaggtggcgcaattttctctgttggtgttacatcagtt
cctaaatatttcccaaaagaaaaagtaggtctagcaaatggtatttatggtatggggaat
atcggtacagcagtttcttcatttttagcaccaccgatagcgggtattattggttggcaa
acaacagttagaagttacttaattattatcgctttatttgcattaattatgttcattttt
ggtgacacacaagaacgtaaaattaaagtgccattaatggcccaaatgaaaacattatct
aaaaactacaaattatattacttaagttattggtatttcattacttttggtgcttttgta
gcatttggtattttcttacctaactacttagtaaatcattttggaattgacaaagtagat
gctggtattcgttcaggtgtattcattgcgctggcaacattcttgagaccaataggtggt
atactaggtgataaatttaatgcagttaaagtactgatgattgattttgttattatgatt
atcggtgccgttattttaggtatttcagaccatatcgcattattcactgtaggctgttta
acaataagtatttgtgcaggtattggtaacggcttaatttttaaattagtaccatcctac
ttctcaaatgaagcaggatcagcaaatggtatcgtatcaatgatgggtggtttaggagga
ttcttcccaccgttggtcatcacatacgtagctaatttaacaggttcaagccatttagca
tttattttcttagcggtatttggatgcattgcattatttaccatgcgccatttatatcaa
aaagaatatggttcattgaaacacagttga

DBGET integrated database retrieval system