KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA): SaurJH9_2716
Entry
SaurJH9_2716      CDS       T00522                                 

Definition
(GenBank) transcriptional regulator, PadR family
  KO
K10947  PadR family transcriptional regulator, regulatory protein PadR
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA)
Brite
KEGG Orthology (KO) [BR:saj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:saj03000]
    SaurJH9_2716
Transcription factors [BR:saj03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    SaurJH9_2716
Motif
Pfam: PadR HTH_34 TrmB DUF6429 FUR LexA_DNA_bind
Other DBs
NCBI-ProteinID: ABQ50492
Position
complement(2887244..2887582)
AA seq 112 aa
MSVSDQIMKGLLDGAILGLIAQGETYGYEIMTKLKNQEFPEISEGSIYPVLMRLNKKGYV
DTTIKKSSNGGPRRKYYTITDSGLKELKVFKSKWQALNKGMINLFGGENDVN
NT seq 339 nt   +upstreamnt  +downstreamnt
atgtcagtgtcagatcagattatgaaaggtctcttagatggggcgatattaggtctcatt
gcccaaggcgaaacgtatggatatgaaattatgacgaaacttaagaatcaagagtttcca
gagataagtgagggtagtatttatccagttttaatgcgtttaaacaaaaaaggatacgtt
gatacgacaataaaaaaatctagtaatggcggcccgaggcggaaatactatacgattacc
gattcaggtttaaaggaactaaaagtatttaaatcaaaatggcaagctttgaataaaggg
atgattaacttgtttggaggggaaaacgatgttaactaa

DBGET integrated database retrieval system