KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VRSA): SaurJH9_0599Help
Entry
SaurJH9_0599      CDS       T00522                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VRSA)
Pathway
saj00071  Fatty acid degradation
saj00072  Synthesis and degradation of ketone bodies
saj00280  Valine, leucine and isoleucine degradation
saj00310  Lysine degradation
saj00362  Benzoate degradation
saj00380  Tryptophan metabolism
saj00620  Pyruvate metabolism
saj00630  Glyoxylate and dicarboxylate metabolism
saj00640  Propanoate metabolism
saj00650  Butanoate metabolism
saj00900  Terpenoid backbone biosynthesis
saj01100  Metabolic pathways
saj01110  Biosynthesis of secondary metabolites
saj01120  Microbial metabolism in diverse environments
saj01130  Biosynthesis of antibiotics
saj01200  Carbon metabolism
saj01212  Fatty acid metabolism
saj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:saj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SaurJH9_0599
   00630 Glyoxylate and dicarboxylate metabolism
    SaurJH9_0599
   00640 Propanoate metabolism
    SaurJH9_0599
   00650 Butanoate metabolism
    SaurJH9_0599
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SaurJH9_0599
   00072 Synthesis and degradation of ketone bodies
    SaurJH9_0599
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SaurJH9_0599
   00310 Lysine degradation
    SaurJH9_0599
   00380 Tryptophan metabolism
    SaurJH9_0599
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SaurJH9_0599
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SaurJH9_0599
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SaurJH9_0599
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:saj04147]
    SaurJH9_0599
Enzymes [BR:saj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SaurJH9_0599
Exosome [BR:saj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SaurJH9_0599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABQ48403
Position
669169..670308
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYPEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggtggcact
ttaaaacatttagagccagaacaattgcttaaacctttattccaacattttaaagagaag
tatccagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggcttaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatc
caagccggagctggcaaggtatatattgcaggtggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtggcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaactg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaatactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtaatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagcgttcagtgcacaggtagttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgactcgattattttatatgtttgacaaagagactatg
attgcatctatggggatagggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system